Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Aminoacylase-1 (ACY1)

Product Specifications

Product Name Alternative

N-acyl-L-amino-acid amidohydrolase

Abbreviation

Recombinant Human ACY1 protein

Gene Name

ACY1

UniProt

Q03154

Expression Region

1-408aa

Organism

Homo sapiens (Human)

Target Sequence

MTSKGPEEEHPSVTLFRQYLRIRTVQPKPDYGAAVAFFEETARQLGLGCQKVEVAPGYVVTVLTWPGTNPTLSSILLNSHTDVVPVFKEHWSHDPFEAFKDSEGYIYARGAQDMKCVSIQYLEAVRRLKVEGHRFPRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQAAGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCKDMNLTLEPEIMPAATDNRYIRAVGVPALGFSPMNRTPVLLHDHDERLHEAVFLRGVDIYTRLLPALASVPALPSDS

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Involved in the hydrolysis of N-acylated or N-acetylated amino acids (except L-aspartate) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Involved in the hydrolysis of N-acylated or N-acetylated amino acids (except L-aspartate) .

Molecular Weight

72.9 kDa

References & Citations

"The nucleotide sequence of human aminoacylase-1." Mitta M., Kato I., Tsunasawa S. Biochim. Biophys. Acta 1174:201-203 (1993)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Inositol 1,4,5-triphosphate receptor associated 1 (Irag1), partial
CSB-EP894372MO-01 20 µg

Recombinant Mouse Inositol 1,4,5-triphosphate receptor associated 1 (Irag1), partial

Sign In for Pricing
View Details
Recombinant Mouse Inositol 1,4,5-triphosphate receptor associated 1 (Irag1), partial
CSB-EP894372MO-02 100 µg

Recombinant Mouse Inositol 1,4,5-triphosphate receptor associated 1 (Irag1), partial

Sign In for Pricing
View Details
Recombinant Mouse Inositol 1,4,5-triphosphate receptor associated 1 (Irag1), partial
CSB-EP894372MO-03 1 mg

Recombinant Mouse Inositol 1,4,5-triphosphate receptor associated 1 (Irag1), partial

Sign In for Pricing
View Details
B4GALT7 Knockout Hela Polyclonal Cells
ARG21177 1 Million

B4GALT7 Knockout Hela Polyclonal Cells

Sign In for Pricing
View Details
ETV3 (NM_005240) Human Tagged Lenti ORF Clone
RC204995L4 10 µg

ETV3 (NM_005240) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Anti-KCNA1/Kv1.1 Rabbit Monoclonal Antibody
MBS179740-01 0.03 mL

Anti-KCNA1/Kv1.1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details