Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fatty acid-binding protein 5 (FABP5)

Product Specifications

Product Name Alternative

Epidermal-type fatty acid-binding protein1 Publication E-FABP1 Publication Fatty acid-binding protein, epidermal Psoriasis-associated fatty acid-binding protein homolog

Abbreviation

Recombinant Human FABP5 protein

Gene Name

FABP5

UniProt

Q01469

Expression Region

1-135aa

Organism

Homo sapiens (Human)

Target Sequence

MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE

Tag

N-terminal 10xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

Intracellular carrier for long-chain fatty acids and related active lipids, such as the endocannabinoid, that regulates the metabolism and actions of the ligands they bind. In addition to the cytosolic transport, selectively delivers specific fatty acids from the cytosol to the nucleus, wherein they activate nuclear receptors (PubMed:22170058, PubMed:21395585) . Delivers retinoic acid to the nuclear receptor peroxisome proliferator-activated receptor delta; which promotes proliferation and survival. May also serve as a synaptic carrier of endocannabinoid at central synapses and thus controls retrograde endocannabinoid signaling. Modulates inflammation by regulating PTGES induction via NF-kappa-B activation, and prostaglandin E2 (PGE2) biosynthesis during inflammation (By similarity) . May be involved in keratinocyte differentiation (PubMed:8092987) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

21.2 kDa

References & Citations

"Solution structure and backbone dynamics of human epidermal-type fatty acid-binding protein (E-FABP) ." Gutierrez-Gonzalez L.H., Ludwig C., Hohoff C., Rademacher M., Hanhoff T., Rueterjans H., Spener F., Luecke C. Biochem. J. 364:725-737 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TNS4 Protein Lysate (Mouse) with C-HA Tag
47270034 100 μg

TNS4 Protein Lysate (Mouse) with C-HA Tag

Ask
View Details
alpha,omega-Bisbromo poly(ethylene glycol), PEG molecular weight 3,000 daltons
sc-353003 500 mg

alpha,omega-Bisbromo poly(ethylene glycol), PEG molecular weight 3,000 daltons

Ask
View Details
Rabbit anti-HDAC2 Antibody, Affinity Purified
A300-704A 100 µg

Rabbit anti-HDAC2 Antibody, Affinity Purified

Ask
View Details
HADHB Protein Vector (Human) (pPM-C-HA)
22991021 500 ng

HADHB Protein Vector (Human) (pPM-C-HA)

Ask
View Details