Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human NEDD8 (NEDD8)

Product Specifications

Product Name Alternative

Neddylin Neural precursor cell expressed developmentally down-regulated protein 8

Abbreviation

Recombinant Human NEDD8 protein

Gene Name

NEDD8

UniProt

Q15843

Expression Region

1-81aa

Organism

Homo sapiens (Human)

Target Sequence

MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGGGGLRQ

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

Ubiquitin-like protein which plays an important role in cell cycle control and embryogenesis. Covalent attachment to its substrates requires prior activation by the E1 complex UBE1C-APPBP1 and linkage to the E2 enzyme UBE2M. Attachment of NEDD8 to cullins activates their associated E3 ubiquitin ligase activity, and thus promotes polyubiquitination and proteasomal degradation of cyclins and other regulatory proteins.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Ubiquitin-like protein which plays an important role in cell cycle control and embryogenesis. Covalent attachment to its substrates requires prior activation by the E1 complex UBE1C-APPBP1 and linkage to the E2 enzyme UBE2M. Attachment of NEDD8 to cullins activates their associated E3 ubiquitin ligase activity, and thus promotes polyubiquitination and proteasomal degradation of cyclins and other regulatory proteins.

Molecular Weight

35.6 kDa

References & Citations

"A new NEDD8-ligating system for cullin-4A." Osaka F., Kawasaki H., Aida N., Saeki M., Chiba T., Kawashima S., Tanaka K., Kato S. Genes Dev. 12:2263-2268 (1998)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAFK (V-Maf Musculoaponeurotic Fibrosarcoma Oncogene Homolog K (Avian), MAFK Protein, FLJ32205, MGC71717, NFE2U, P18)
218322-01 50 µL

MAFK (V-Maf Musculoaponeurotic Fibrosarcoma Oncogene Homolog K (Avian), MAFK Protein, FLJ32205, MGC71717, NFE2U, P18)

Sign In for Pricing
View Details
MAFK (V-Maf Musculoaponeurotic Fibrosarcoma Oncogene Homolog K (Avian), MAFK Protein, FLJ32205, MGC71717, NFE2U, P18)
218322-02 100 µL

MAFK (V-Maf Musculoaponeurotic Fibrosarcoma Oncogene Homolog K (Avian), MAFK Protein, FLJ32205, MGC71717, NFE2U, P18)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain K12) ACNA Polyclonal Antibody
MBS7147090-01 0.05 mL

Rabbit anti-Escherichia coli (strain K12) ACNA Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain K12) ACNA Polyclonal Antibody
MBS7147090-02 0.1 mL

Rabbit anti-Escherichia coli (strain K12) ACNA Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain K12) ACNA Polyclonal Antibody
MBS7147090-03 5x 0.1 mL

Rabbit anti-Escherichia coli (strain K12) ACNA Polyclonal Antibody

Sign In for Pricing
View Details
Rat Dhodh Protein
orb1476929-01 20 µg

Rat Dhodh Protein

Sign In for Pricing
View Details