Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human High mobility group nucleosome-binding domain-containing protein 4 (HMGN4)

Product Specifications

Product Name Alternative

HMGN4; HMG17L3; NHC; High mobility group nucleosome-binding domain-containing protein 4; Non-histone chromosomal protein HMG-17-like 3; Non-histone chromosomal protein

Abbreviation

Recombinant Human HMGN4 protein

Gene Name

HMGN4

UniProt

O00479

Expression Region

1-90aa

Organism

Homo sapiens (Human)

Target Sequence

MPKRKAKGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPRPKKASAKKGEKLPKGRKGKADAGKDGNNPAKNRDASTLQSQKAEGTGDAK

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Non-histone chromosomal protein HMG-17-like 3

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

36.5 kDa

References & Citations

"A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767 (2008)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRATD1 (NM_145175) Human Recombinant Protein
TP710355 20 µg

LRATD1 (NM_145175) Human Recombinant Protein

Sign In for Pricing
View Details
APC Anti-Human CD303/BDCA-2 Antibody[201A]
E-AB-F1162E-01 20 Tests

APC Anti-Human CD303/BDCA-2 Antibody[201A]

Sign In for Pricing
View Details
APC Anti-Human CD303/BDCA-2 Antibody[201A]
E-AB-F1162E-02 100 Tests

APC Anti-Human CD303/BDCA-2 Antibody[201A]

Sign In for Pricing
View Details
APC Anti-Human CD303/BDCA-2 Antibody[201A]
E-AB-F1162E-03 2x 100 Tests

APC Anti-Human CD303/BDCA-2 Antibody[201A]

Sign In for Pricing
View Details
Frozen Tissue Blocks, Ovary
CB621547 1 Block

Frozen Tissue Blocks, Ovary

Sign In for Pricing
View Details
Divicine Sulfate
TRC-D494458-25MG 25 mg

Divicine Sulfate

Sign In for Pricing
View Details