Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Alpha-hemoglobin-stabilizing protein (AHSP)

Product Specifications

Product Name Alternative

Erythroid differentiation-related factor Erythroid-associated factor

Abbreviation

Recombinant Human AHSP protein

Gene Name

AHSP

UniProt

Q9NZD4

Expression Region

1-102aa

Organism

Homo sapiens (Human)

Target Sequence

MALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKSHELPSHPPPSS

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Acts as a chaperone to prevent the harmful aggregation of alpha-hemoglobin during normal erythroid cell development. Specifically protects free alpha-hemoglobin from precipitation. It is predicted to modulate pathological states of alpha-hemoglobin excess such as beta-thalassemia.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Acts as a chaperone to prevent the harmful aggregation of alpha-hemoglobin during normal erythroid cell development. Specifically protects free alpha-hemoglobin from precipitation. It is predicted to modulate pathological states of alpha-hemoglobin excess such as beta-thalassemia.

Molecular Weight

38.8 kDa

References & Citations

"A novel erythroid-specific marker of transmissible spongiform encephalopathies." Miele G., Manson J., Clinton M. Nat. Med. 7:361-364 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bcl2 Binding component 3 (BBC3) (C-term) Rabbit Polyclonal Antibody
AP07278PU-N 50 µg

Bcl2 Binding component 3 (BBC3) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS507218 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
C1orf104 (RUSC1-AS1) (NM_001039517) Human Over-expression Lysate
LY422064 100 µg

C1orf104 (RUSC1-AS1) (NM_001039517) Human Over-expression Lysate

Sign In for Pricing
View Details
Cholic Acid
TRC-C432600-50G 50 g

Cholic Acid

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD31 Antibody[390]
E-AB-F1180L-01 50 Tests

Elab Fluor® 488 Anti-Mouse CD31 Antibody[390]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD31 Antibody[390]
E-AB-F1180L-02 100 Tests

Elab Fluor® 488 Anti-Mouse CD31 Antibody[390]

Sign In for Pricing
View Details