Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human DNA fragmentation factor subunit alpha (DFFA)

Product Specifications

Product Name Alternative

DNA fragmentation factor 45KDA subunit

Abbreviation

Recombinant Human DFFA protein

Gene Name

DFFA

UniProt

O00273

Expression Region

1-331aa

Organism

Homo sapiens (Human)

Target Sequence

MEVTGDAGVPESGEIRTLKPCLLRRNYSREQHGVAASCLEDLRSKACDILAIDKSLTPVTLVLAEDGTIVDDDDYFLCLPSNTKFVALASNEKWAYNNSDGGTAWISQESFDVDETDSGAGLKWKNVARQLKEDLSSIILLSEEDLQMLVDAPCSDLAQELRQSCATVQRLQHTLQQVLDQREEVRQSKQLLQLYLQALEKEGSLLSKQEESKAAFGEEVDAVDTGISRETSSDVALASHILTALREKQAPELSLSSQDLELVTKEDPKALAVALNWDIKKTETVQEACEWELALRLQQTQSLHSLRSISASKASPPGDLQNPKRARQDPT

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

Inhibitor of the caspase-activated DNase (DFF40) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Inhibitor of the caspase-activated DNase (DFF40) .

Molecular Weight

63.6 kDa

References & Citations

"DFF, a heterodimeric protein that functions downstream of caspase-3 to trigger DNA fragmentation during apoptosis." Liu X., Zou H., Slaughter C., Wang X. Cell 89:175-184 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of BC007721

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Pdp2 shRNA (UAS) - Lentiviral mouse Pdp2 shRNA (UAS) (100)
GTR15273606 1 Vial

Lentiviral mouse Pdp2 shRNA (UAS) - Lentiviral mouse Pdp2 shRNA (UAS) (100)

Sign In for Pricing
View Details
Rat D Galectin ELISA Kit
MBS7203132-01 48 Well

Rat D Galectin ELISA Kit

Sign In for Pricing
View Details
Rat D Galectin ELISA Kit
MBS7203132-02 96 Well

Rat D Galectin ELISA Kit

Sign In for Pricing
View Details
Rat D Galectin ELISA Kit
MBS7203132-03 5x 96 Well

Rat D Galectin ELISA Kit

Sign In for Pricing
View Details
Rat D Galectin ELISA Kit
MBS7203132-04 10x 96 Well

Rat D Galectin ELISA Kit

Sign In for Pricing
View Details
Gabapentin related compound A
FG23633-01 500 g

Gabapentin related compound A

Sign In for Pricing
View Details