Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CCAAT/enhancer-binding protein gamma (CEBPG)

Product Specifications

Product Name Alternative

C/EBP gamma; CCAAT/enhancer binding protein (C/EBP) gamma; CCAAT/enhancer binding protein gamma; CCAAT/enhancer-binding protein gamma; CEBPG; CEBPG_HUMAN; GPE1BP; IG/EBP 1; IG/EBP1

Abbreviation

Recombinant Human CEBPG protein

Gene Name

CEBPG

UniProt

P53567

Expression Region

1-150aa

Organism

Homo sapiens (Human)

Target Sequence

MSKISQQNSTPGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQSISTENTTADGDNAGQ

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Transcription factor that binds to the promoter and the enhancer regions of target genes. Binds to the enhancer element PRE-I (positive regulatory element-I) of the IL-4 gene. Binds to the promoter and the enhancer of the immunoglobulin heavy chain. Binds to GPE1, a cis-acting element in the G-CSF gene promoter.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Transcription factor that binds to the promoter and the enhancer regions of target genes. Binds to the enhancer element PRE-I (positive regulatory element-I) of the IL-4 gene

Molecular Weight

43.4 kDa

References & Citations

"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC) ." The MGC Project Team Genome Res. 14:2121-2127 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-KIT (Y570) Antibody
E45R05280G-1 100 µL

Phospho-KIT (Y570) Antibody

Sign In for Pricing
View Details
5',3'-Nucleotidase, Cytosolic (NT5C) DIY ELISA Kit
MBS2163266-01 5x 96 Tests

5',3'-Nucleotidase, Cytosolic (NT5C) DIY ELISA Kit

Sign In for Pricing
View Details
5',3'-Nucleotidase, Cytosolic (NT5C) DIY ELISA Kit
MBS2163266-02 5x 96 Tests + MBS2089471 (Support Pack 1,5x 96 Tests)

5',3'-Nucleotidase, Cytosolic (NT5C) DIY ELISA Kit

Sign In for Pricing
View Details
5',3'-Nucleotidase, Cytosolic (NT5C) DIY ELISA Kit
MBS2163266-03 10x 96 Tests

5',3'-Nucleotidase, Cytosolic (NT5C) DIY ELISA Kit

Sign In for Pricing
View Details
5',3'-Nucleotidase, Cytosolic (NT5C) DIY ELISA Kit
MBS2163266-04 10x 96 Tests + MBS2089471 (Support Pack 1, 10x 96 Tests)

5',3'-Nucleotidase, Cytosolic (NT5C) DIY ELISA Kit

Sign In for Pricing
View Details
HP1BP3 Knockout A549 Polyclonal Cells
ARG33676 1 Million

HP1BP3 Knockout A549 Polyclonal Cells

Sign In for Pricing
View Details