Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Beta-catenin-interacting protein 1 (CTNNBIP1)

Product Specifications

Product Name Alternative

Inhibitor of beta-catenin and Tcf-4

Abbreviation

Recombinant Human CTNNBIP1 protein

Gene Name

CTNNBIP1

UniProt

Q9NSA3

Expression Region

1-81aa

Organism

Homo sapiens (Human)

Target Sequence

MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMAFSRSETEDRRQ

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Prevents the interaction between CTNNB1 and TCF family members, and acts as negative regulator of the Wnt signaling pathway.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Prevents the interaction between CTNNB1 and TCF family members, and acts as negative regulator of the Wnt signaling pathway.

Molecular Weight

36.2 kDa

References & Citations

"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC) ." The MGC Project Team Genome Res. 14:2121-2127 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse SCF (HEK293-expressed , His Tag)
OM770104-01 2 μg

Recombinant Mouse SCF (HEK293-expressed , His Tag)

Sign In for Pricing
View Details
Recombinant Mouse SCF (HEK293-expressed , His Tag)
OM770104-02 10 μg

Recombinant Mouse SCF (HEK293-expressed , His Tag)

Sign In for Pricing
View Details
Recombinant Mouse SCF (HEK293-expressed , His Tag)
OM770104-03 50 μg

Recombinant Mouse SCF (HEK293-expressed , His Tag)

Sign In for Pricing
View Details
Recombinant Mouse SCF (HEK293-expressed , His Tag)
OM770104-04 100 μg

Recombinant Mouse SCF (HEK293-expressed , His Tag)

Sign In for Pricing
View Details
Recombinant Mouse SCF (HEK293-expressed , His Tag)
OM770104-05 250 μg

Recombinant Mouse SCF (HEK293-expressed , His Tag)

Sign In for Pricing
View Details
Recombinant Mouse SCF (HEK293-expressed , His Tag)
OM770104-06 500 μg

Recombinant Mouse SCF (HEK293-expressed , His Tag)

Sign In for Pricing
View Details