Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Bcl-2-modifying factor (BMF)

Product Specifications

Product Name Alternative

Bcl 2 modifying factor; Bcl-2-modifying factor; Bcl2 modifying factor; Bmf; BMF_HUMAN; FLJ00065

Abbreviation

Recombinant Human BMF protein

Gene Name

BMF

UniProt

Q96LC9

Expression Region

1-184aa

Organism

Homo sapiens (Human)

Target Sequence

MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSPGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHQAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWWQILLFLHNLALNGEENRNGAGPR

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

May play a role in apoptosis. Isoform 1 seems to be the main initiator.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May play a role in apoptosis. Isoform 1 seems to be the main initiator.

Molecular Weight

47.5 kDa

References & Citations

"Bmf: a proapoptotic BH3-only protein regulated by interaction with the myosin V actin motor complex, activated by anoikis." Puthalakath H., Villunger A., O'Reilly L.A., Beaumont J.G., Coultas L., Cheney R.E., Huang D.C.S., Strasser A. Science 293:1829-1832 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of BC069505

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCMV-Otx2-3xFLAG-Neo Plasmid
PVT80906 2 µg

PCMV-Otx2-3xFLAG-Neo Plasmid

Sign In for Pricing
View Details
WNT1 Inducible Signaling Pathway Protein 1 (WISP1) Mouse ELISA Kit
I2834 96 Tests

WNT1 Inducible Signaling Pathway Protein 1 (WISP1) Mouse ELISA Kit

Sign In for Pricing
View Details
K1826 Rabbit Polyclonal Antibody (HRP)
orb477140 100 µL

K1826 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Anti-PLXNC1 Antibody Picoband® Fluoro488 Conjugated
A10941-1-Fluoro488 100 µg/Vial

Anti-PLXNC1 Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
Hsd17b7 ORF Vector (Mouse) (pORF)
ORF047502 1.0 µg DNA

Hsd17b7 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
MARK4 Rabbit Polyclonal Antibody (BF405)
orb2416050 100 µL

MARK4 Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details