Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Elongin-B (ELOB)

Product Specifications

Product Name Alternative

Elongin 18KDA subunit Elongin-B

Abbreviation

Recombinant Human ELOB protein

Gene Name

ELOB

UniProt

Q15370

Expression Region

1-118aa

Organism

Homo sapiens (Human)

Target Sequence

MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

SIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past template-encoded arresting sites. Subunit A is transcriptionally active and its transcription activity is strongly enhanced by binding to the dimeric complex of the SIII regulatory subunits B and C (elongin BC complex) . The elongin BC complex seems to be involved as an adapter protein in the proteasomal degradation of target proteins via different E3 ubiquitin ligase complexes, including the von Hippel-Lindau ubiquitination complex CBC (VHL) . By binding to BC-box motifs it seems to link target recruitment subunits, like VHL and members of the SOCS box family, to Cullin/RBX1 modules that activate E2 ubiquitination enzymes.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

SIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past template-encoded arresting sites. Subunit A is transcriptionally active and its transcription activity is strongly enhanced by binding to the dimeric complex of the SIII regulatory subunits B and C (elongin BC complex)

Molecular Weight

40.1 kDa

References & Citations

"Positive regulation of general transcription factor SIII by a tailed ubiquitin homolog." Garrett K.P., Aso T., Bradsher J.N., Foundling S.I., Lane W.S., Conaway R.C., Conaway J.W. Proc. Natl. Acad. Sci. U.S.A. 92:7172-7176 (1995)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human HHAT activation kit by CRISPRa
GA110921 1 Kit

Human HHAT activation kit by CRISPRa

Sign In for Pricing
View Details
Biotin-16-UTP, 10 mM in pH 7.5 Tris-HCl Buffer
#40023 1x 25 µL

Biotin-16-UTP, 10 mM in pH 7.5 Tris-HCl Buffer

Sign In for Pricing
View Details
CPSF7 (NM_001136040) Human Over-expression Lysate
LC427787 20 µg

CPSF7 (NM_001136040) Human Over-expression Lysate

Sign In for Pricing
View Details
Transglutaminase 2 (TGM2) Mouse Monoclonal Antibody [Clone ID: OTI4H5]
CF809245 100 µg

Transglutaminase 2 (TGM2) Mouse Monoclonal Antibody [Clone ID: OTI4H5]

Sign In for Pricing
View Details
Benchtop Low Speed Centrifuge BCBL-204
BCBL-204 1 Unit

Benchtop Low Speed Centrifuge BCBL-204

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon: sigmoid
CS808313 5x 5 µm

Tissue FFPE Sections, Colon: sigmoid

Sign In for Pricing
View Details