Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Elongin-B (ELOB)

Product Specifications

Product Name Alternative

Elongin 18KDA subunit Elongin-B

Abbreviation

Recombinant Human ELOB protein

Gene Name

ELOB

UniProt

Q15370

Expression Region

1-118aa

Organism

Homo sapiens (Human)

Target Sequence

MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

SIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past template-encoded arresting sites. Subunit A is transcriptionally active and its transcription activity is strongly enhanced by binding to the dimeric complex of the SIII regulatory subunits B and C (elongin BC complex) . The elongin BC complex seems to be involved as an adapter protein in the proteasomal degradation of target proteins via different E3 ubiquitin ligase complexes, including the von Hippel-Lindau ubiquitination complex CBC (VHL) . By binding to BC-box motifs it seems to link target recruitment subunits, like VHL and members of the SOCS box family, to Cullin/RBX1 modules that activate E2 ubiquitination enzymes.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

SIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past template-encoded arresting sites. Subunit A is transcriptionally active and its transcription activity is strongly enhanced by binding to the dimeric complex of the SIII regulatory subunits B and C (elongin BC complex)

Molecular Weight

40.1 kDa

References & Citations

"Positive regulation of general transcription factor SIII by a tailed ubiquitin homolog." Garrett K.P., Aso T., Bradsher J.N., Foundling S.I., Lane W.S., Conaway R.C., Conaway J.W. Proc. Natl. Acad. Sci. U.S.A. 92:7172-7176 (1995)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fmoc-Asn (Trt) TentaGel® R TRT Resin
RA1204.5G 5 g

Fmoc-Asn (Trt) TentaGel® R TRT Resin

Sign In for Pricing
View Details
Dibenzo[b,f][1,4]thiazepin-11(10H)-one, 5-oxide
TRC-D313110-500MG 500 mg

Dibenzo[b,f][1,4]thiazepin-11(10H)-one, 5-oxide

Sign In for Pricing
View Details
KCNK18 Rabbit Polyclonal Antibody
ER1901-46 100 µL

KCNK18 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IGLON5 (NM_001101372) Human Recombinant Protein
TP325495 20 µg

IGLON5 (NM_001101372) Human Recombinant Protein

Sign In for Pricing
View Details
Xenazoic Acid
TRC-X744450-5MG 5 mg

Xenazoic Acid

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS629525 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details