Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Gastrotropin (FABP6)

Product Specifications

Product Name Alternative

Fatty acid-binding protein 6 Ileal lipid-binding protein

Abbreviation

Recombinant Human FABP6 protein

Gene Name

FABP6

UniProt

P51161

Expression Region

1-128aa

Organism

Homo sapiens (Human)

Target Sequence

MAFTGKFEMESEKNYDEFMKLLGISSDVIEKAHNFKIVTEVQQDGQDFTWSQHYYGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Binds to bile acids and is involved in enterohepatic bile acid metabolism. Required for efficient apical to basolateral transport of conjugated bile acids in ileal enterocytes. In vitro binds to bile acids in the order: deoxycholic acid > cholic acid > chenodeoxycholic acid and respective BA conjugation modifies affinities in the order taurine-conjugated > glycine-conjugated > unconjugated bile acids. Stimulates gastric acid and pepsinogen secretion

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Binds to bile acids and is involved in enterohepatic bile acid metabolism. Required for efficient apical to basolateral transport of conjugated bile acids in ileal enterocytes (By similarity) . In vitro binds to bile acids in the order

Molecular Weight

41.4 kDa

References & Citations

"A novel variant of ileal bile acid binding protein is up-regulated through nuclear factor-kappaB activation in colorectal adenocarcinoma." Fang C., Dean J., Smith J.W. Cancer Res. 67:9039-9046 (2007)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of BC022489

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Th Mouse Monoclonal Antibody [Clone ID: TH-100]
AM20681PU-N 100 µg

Th Mouse Monoclonal Antibody [Clone ID: TH-100]

Sign In for Pricing
View Details
Streptavidin, CF®543 Conjugate
#29043 1x 1 mg

Streptavidin, CF®543 Conjugate

Sign In for Pricing
View Details
3,5-Dichlorobenzoic-d3 Acid
TRC-D436564-5MG 5 mg

3,5-Dichlorobenzoic-d3 Acid

Sign In for Pricing
View Details
Sodium Arsenate Heptahydrate
TRC-S960088-5G 5 g

Sodium Arsenate Heptahydrate

Sign In for Pricing
View Details
Human ABHD13 activation kit by CRISPRa
GA113789 1 Kit

Human ABHD13 activation kit by CRISPRa

Sign In for Pricing
View Details
rel-cis-Prucalopride-N-oxide
TRC-P143960-25MG 25 mg

rel-cis-Prucalopride-N-oxide

Sign In for Pricing
View Details