Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sorcin (SRI)

Product Specifications

Product Name Alternative

22KDA protein CP-22

Abbreviation

Recombinant Human SRI protein

Gene Name

SRI

UniProt

P30626

Expression Region

1-198aa

Organism

Homo sapiens (Human)

Target Sequence

MAYPGHPGAGGGYYPGGYGGAPGGPAFPGQTQDPLYGYFAAVAGQDGQIDADELQRCLTQSGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDTDRSGTVDPQELQKALTTMGFRLSPQAVNSIAKRYSTNGKITFDDYIACCVKLRALTDSFRRRDTAQQGVVNFPYDDFIQCVMSV

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Calcium-binding protein that modulates excitation-contraction coupling in the heart. Contributes to calcium homeostasis in the heart sarcoplasmic reticulum. Modulates the activity of RYR2 calcium channels.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Calcium-binding protein that modulates excitation-contraction coupling in the heart. Contributes to calcium homeostasis in the heart sarcoplasmic reticulum. Modulates the activity of RYR2 calcium channels.

Molecular Weight

48.7 kDa

References & Citations

"Purification, cDNA cloning, and expression of human sorcin in vincristine-resistant HOB1 lymphoma cell lines." Lee W.P. Arch. Biochem. Biophys. 325:217-226 (1996)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRM3 (Metabotropic Glutamate Receptor 3, GLUR3, mGlu3, GPRC1C, MGLUR3) (AP)
MBS6419368-01 0.1 mL

GRM3 (Metabotropic Glutamate Receptor 3, GLUR3, mGlu3, GPRC1C, MGLUR3) (AP)

Sign In for Pricing
View Details
GRM3 (Metabotropic Glutamate Receptor 3, GLUR3, mGlu3, GPRC1C, MGLUR3) (AP)
MBS6419368-02 5x 0.1 mL

GRM3 (Metabotropic Glutamate Receptor 3, GLUR3, mGlu3, GPRC1C, MGLUR3) (AP)

Sign In for Pricing
View Details
BOLA1 Polyclonal Antibody
A62154-020 20 µL

BOLA1 Polyclonal Antibody

Sign In for Pricing
View Details
Guinea Pig Chronic lymphocytic leukemia up regulated protein 1 (CLLU1) ELISA kit
GTR10455059 96 Well

Guinea Pig Chronic lymphocytic leukemia up regulated protein 1 (CLLU1) ELISA kit

Sign In for Pricing
View Details
Phospho-CBL (Tyr700) Rabbit Polyclonal Antibody (PE)
orb504786 100 µL

Phospho-CBL (Tyr700) Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
UBR2 Mouse Monoclonal Antibody (Fluoro488)
orb3084214 100 µg

UBR2 Mouse Monoclonal Antibody (Fluoro488)

Sign In for Pricing
View Details