Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Histone H1.0 (H1-0)

Product Specifications

Product Name Alternative

Histone H1' Histone H1 (0)

Abbreviation

Recombinant Human H1-0 protein

Gene Name

H1-0

UniProt

P07305

Expression Region

1-194aa

Organism

Homo sapiens (Human)

Target Sequence

MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKATPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVKPKAKSSAKRAGKKK

Tag

N-terminal 6xHis-GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Histones H1 are necessary for the condensation of nucleosome chains into higher-order structures. The H1F0 histones are found in cells that are in terminal stages of differentiation or that have low rates of cell division.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Histones H1 are necessary for the condensation of nucleosome chains into higher-order structures. The H1F0 histones are found in cells that are in terminal stages of differentiation or that have low rates of cell division.

Molecular Weight

52.4 kDa

References & Citations

"Differential distribution of lysine and arginine residues in the closely related histones H1 and H5. Analysis of a human H1 gene." Doenecke D., Tonjes R. J. Mol. Biol. 187:461-464 (1986)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(2E)-3-(Phenyl-d5)-2-propenoic Acid
TRC-P336186-50MG 50 mg

(2E)-3-(Phenyl-d5)-2-propenoic Acid

Sign In for Pricing
View Details
Frozen Tissue Sections, Vagina
CS636501 5x 5 µm

Frozen Tissue Sections, Vagina

Sign In for Pricing
View Details
PSG4 (NM_002780) Human Over-expression Lysate
LC419108 20 µg

PSG4 (NM_002780) Human Over-expression Lysate

Sign In for Pricing
View Details
Vitamin D3 Receptor (Ab-51) Antibody
8B8205-AAT 50 µg

Vitamin D3 Receptor (Ab-51) Antibody

Sign In for Pricing
View Details
CD1b (RIV12), CF740 conjugate, 0.1mg/mL
BNC740317-500 1x 500 µL

CD1b (RIV12), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BC030500 (NM_173411) Mouse Tagged ORF Clone
MG200625 10 µg

BC030500 (NM_173411) Mouse Tagged ORF Clone

Sign In for Pricing
View Details