Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human POU domain, class 5, transcription factor 1 (POU5F1)

Product Specifications

Product Name Alternative

Octamer-binding protein 3

Abbreviation

Recombinant Human POU5F1 protein

Gene Name

POU5F1

UniProt

Q01860

Expression Region

1-360aa

Organism

Homo sapiens (Human)

Target Sequence

MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPGVGPGSEVWGIPPCPPPYEFCGGMAYCGPQVGVGLVPQGGLETSQPEGEAGVGVESNSDGASPEPCTVTPGAVKLEKEKLEQNPEESQDIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN

Tag

N-terminal 6xHis-B2M-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Transcription factor that binds to the octamer motif (5'-ATTTGCAT-3') . Forms a trimeric complex with SOX2 on DNA and controls the expression of a number of genes involved in embryonic development such as YES1, FGF4, UTF1 and ZFP206. Critical for early embryogenesis and for embryonic stem cell pluripotency.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Transcription factor that binds to the octamer motif (5'-ATTTGCAT-3') . Forms a trimeric complex with SOX2 on DNA and controls the expression of a number of genes involved in embryonic development such as YES1, FGF4, UTF1 and ZFP206. Critical for early embryogenesis and for embryonic stem cell pluripotency.

Molecular Weight

52.6 kDa

References & Citations

"Human Oct3 gene family: cDNA sequences, alternative splicing, gene organization, chromosomal location, and expression at low levels in adult tissues." Takeda J., Seino S., Bell G.I. Nucleic Acids Res. 20:4613-4620 (1992)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human FOXQ1 shRNA (UAS) - Lentiviral human FOXQ1 shRNA (UAS) plasmid
GTR15086359 1 Vial

Lentiviral human FOXQ1 shRNA (UAS) - Lentiviral human FOXQ1 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Camel Proenkephalin ELISA Kit
MBS078528-01 48 Well

Camel Proenkephalin ELISA Kit

Sign In for Pricing
View Details
Camel Proenkephalin ELISA Kit
MBS078528-02 96 Well

Camel Proenkephalin ELISA Kit

Sign In for Pricing
View Details
Camel Proenkephalin ELISA Kit
MBS078528-03 5x 96 Well

Camel Proenkephalin ELISA Kit

Sign In for Pricing
View Details
Camel Proenkephalin ELISA Kit
MBS078528-04 10x 96 Well

Camel Proenkephalin ELISA Kit

Sign In for Pricing
View Details
Anti-DR3 Antibody
MBS9239325-01 0.05 mL

Anti-DR3 Antibody

Sign In for Pricing
View Details