Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Reston ebolavirus Matrix protein VP40 (VP40)

Product Specifications

Product Name Alternative

Membrane-associated protein VP40

Abbreviation

Recombinant Reston ebolavirus VP40 protein

Gene Name

VP40

UniProt

Q8JPX9

Expression Region

1-331aa

Organism

Reston ebolavirus (strain Reston-89) (REBOV) (Reston Ebola virus)

Target Sequence

MRRGVLPTAPPAYNDIAYPMSILPTRPSVIVNETKSDVLAVPGADVPSNSMRPVADDNIDHSSHTPSGVASAFILEATVNVISGTKVLMKQIPIWLPLGVADQKIYSFDSTTAAIMLASYTVTHFGKISNPLVRVNRLGPGIPDHPLRLLRLGNQAFLQEFVLPPVQLPQYFTFDLTALKLITQPLPAATWTDETPAGAVNALRPGLSLHPKLRPILLPGKTGKKGHASDLTSPDKIQTIMNAIPDLKIVPIDPTKNIVGIEVPELLVQRLTGKKPQPKNGQPIIPVLLPKYVGLDPISPGDLTMVITQDCDSCHSPASHPYHMDKQNSYQ

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Promotes virus assembly and budding by interacting with host proteins of the multivesicular body pathway. May facilitate virus budding by interacting with the nucleocapsid and the plasma membrane. Specific interactions with membrane-associated GP and VP24 during the budding process may also occur. The hexamer form seems to be involved in budding. The octamer form binds RNA, and may play a role in genome replication (By similarity)

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Promotes virus assembly and budding by interacting with host proteins of the multivesicular body pathway. May facilitate virus budding by interacting with the nucleocapsid and the plasma membrane. Specific interactions with membrane-associated GP and VP24 during the budding process may also occur. The hexamer form seems to be involved in budding. The octamer form binds RNA, and may play a role in genome replication (By similarity) .

Molecular Weight

51.8 kDa

References & Citations

"Molecular characterization of an isolate from the 1989/90 epizootic of Ebola virus Reston among macaques imported into the United States." Groseth A., Stroeher U., Theriault S., Feldmann H.Virus Res. 87:155-163 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Ccdc87 ELISA KIT
ELI-10790m 96 Tests

Mouse Ccdc87 ELISA KIT

Sign In for Pricing
View Details
Human Prohibitin,PHB ELISA KIT
JOT-EK2130Hu 96 wells

Human Prohibitin,PHB ELISA KIT

Sign In for Pricing
View Details
ATG101 (NM_021934) Human Over-expression Lysate
LH11568V 100 µg

ATG101 (NM_021934) Human Over-expression Lysate

Sign In for Pricing
View Details
Gm813 CRISPR/Cas9 KO Plasmid (m)
sc-435907 20 µg

Gm813 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
Anti-DRD2 Antibody (Monoclonal, 35D31)
M00289-1 100 µL

Anti-DRD2 Antibody (Monoclonal, 35D31)

Sign In for Pricing
View Details
N- (2-Chlorobenzyl) -N-phenylamine
sc-329050 500 mg

N- (2-Chlorobenzyl) -N-phenylamine

Sign In for Pricing
View Details