Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Stromal cell-derived factor 2 (Sdf2)

Product Specifications

Product Name Alternative

Sdf2; Stromal cell-derived factor 2; SDF-2

Abbreviation

Recombinant Mouse Sdf2 protein

Gene Name

Sdf2

UniProt

Q9DCT5

Expression Region

19-211aa

Organism

Mus musculus (Mouse)

Target Sequence

SNMAVVTCGSVVKLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVDDSNSYWRIRGKTATVCERGTPIKCGQPIRLTHINTGRNLHSHHFTSPLSGNQEVSAFGEEGEGDYLDDWTVLCNGPYWVRDGEVRFKHSSTDVLLSVTGEQYGRPISGQKEVHGMAQPSQNNYWKAMEGIFMKPSELLRAEVHHAEL

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

26.4 kDa

References & Citations

"Isolation and characterization of a novel secretory protein, stromal cell-derived factor-2 (SDF-2) using the signal sequence trap method." Hamada T., Tashiro K., Tada H., Inazawa J., Shirozu M., Shibahara K., Nakamura T., Martina N., Nakano T., Honjo T.Gene 176:211-214 (1996)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gentamycin (Gentamicin) discontinued
G2025-04 500 µL

Gentamycin (Gentamicin) discontinued

Sign In for Pricing
View Details
HDAC3 Rabbit Polyclonal Antibody (BF647)
orb1593195 100 µL

HDAC3 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
PDK4-IN-1 hydrochloride
C03602-25mg 25 mg

PDK4-IN-1 hydrochloride

Sign In for Pricing
View Details
A2M polyclonal antibody
orb645792-01 50 μL

A2M polyclonal antibody

Sign In for Pricing
View Details
A2M polyclonal antibody
orb645792-02 100 µL

A2M polyclonal antibody

Sign In for Pricing
View Details
A2M polyclonal antibody
orb645792-03 200 µL

A2M polyclonal antibody

Sign In for Pricing
View Details