Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chikungunya virus Non-structural protein 4 (nsP4), partial

Product Specifications

Product Name Alternative

Polyprotein nsP1234

Abbreviation

Recombinant Chikungunya virus nsp4 protein, partial

Gene Name

Nsp4

UniProt

Q8JUX6

Expression Region

2228-2474aa

Organism

Chikungunya virus (strain S27-African prototype) (CHIKV)

Target Sequence

DTVLETDIASFDKSQDDSLALTALMLLEDLGVDHSLLDLIEAAFGEISSCHLPTGTRFKFGAMMKSGMFLTLFVNTLLNITIASRVLEDRLTKSACAAFIGDDNIIHGVVSDELMAARCATWMNMEVKIIDAVVSQKAPYFCGGFILHDIVTGTACRVADPLKRLFKLGKPLAAGDEQDEDRRRALADEVVRWQRTGLIDELEKAVYSRYEVQGISVVVMSMATFASSRSNFEKLRGPVVTLYGGPK

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

P123 is short-lived polyproteins, accumulating during early stage of infection. It localizes the viral replication complex to the cytoplasmic surface of modified endosomes and lysosomes. By interacting with nsP4, it starts viral genome replication into antigenome. After these early events, P123 is cleaved sequentially into nsP1, nsP2 and nsP3. This sequence of delayed processing would allow correct assembly and membrane association of the RNA polymerase complex (By similarity) .

Molecular Weight

31.1 kDa

References & Citations

"Complete nucleotide sequence of chikungunya virus and evidence for an internal polyadenylation site."Khan A.H., Morita K., Parquet Md Mdel C., Hasebe F., Mathenge E.G., Igarashi A.J. Gen. Virol. 83:3075-3084 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ENTPD2 (N-term) Rabbit Polyclonal Antibody
AP51438PU-N 400 µL

ENTPD2 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MYO1D (NM_001303280) Human Tagged ORF Clone
RG238226 10 µg

MYO1D (NM_001303280) Human Tagged ORF Clone

Sign In for Pricing
View Details
VivoBriteTM Rapid Antibody Labeling Kit for Small Animal In Vivo Imaging, CF®680 SE
#92160 1 Kit

VivoBriteTM Rapid Antibody Labeling Kit for Small Animal In Vivo Imaging, CF®680 SE

Sign In for Pricing
View Details
Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (N/A), CF740 conjugate, 0.1mg/mL
BNC741826-100 1x 100 µL

Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (N/A), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18/1190), CF740 conjugate, 0.1mg/mL
BNC741190-100 1x 100 µL

Cytokeratin 18 (KRT18/1190), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Normesuximide
TRC-N720500-5G 5 g

Normesuximide

Sign In for Pricing
View Details