Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Enterotoxin type H (entH)

Product Specifications

Product Name Alternative

SEH

Abbreviation

Recombinant Staphylococcus aureus entH protein

Gene Name

EntH

UniProt

P0A0M0

Expression Region

25-241aa

Organism

Staphylococcus aureus

Target Sequence

EDLHDKSELTDLALANAYGQYNHPFIKENIKSDEISGEKDLIFRNQGDSGNDLRVKFATADLAQKFKNKNVDIYGASFYYKCEKISENISECLYGGTTLNSEKLAQERVIGANVWVDGIQKETELIRTNKKNVTLQELDIKIRKILSDKYKIYYKDSEISKGLIEFDMKTPRDYSFDIYDLKGENDYEIDKIYEDNKTLKSDDISHIDVNLYTKKKV

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Relevance

Staphylococcal enterotoxins cause the intoxication staphylococcal food poisoning syndrome. The illness characterized by high fever, hypotension, diarrhea, shock, and in some cases death.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Staphylococcal enterotoxins cause the intoxication staphylococcal food poisoning syndrome. The illness characterized by high fever, hypotension, diarrhea, shock, and in some cases death.

Molecular Weight

27.1 kDa

References & Citations

"The crystal structure of staphylococcal enterotoxin H: implications for binding properties to MHC class II and TcR molecules."Haekansson M., Petersson K., Nilsson H., Forsberg G., Bjoerk P., Antonsson P., Svensson L.A.J. Mol. Biol. 302:527-537 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gastrokine 1, Human (sf9, His)
HY-P76356-01 10 µg

Gastrokine 1, Human (sf9, His)

Sign In for Pricing
View Details
Gastrokine 1, Human (sf9, His)
HY-P76356-02 50 µg

Gastrokine 1, Human (sf9, His)

Sign In for Pricing
View Details
Gastrokine 1, Human (sf9, His)
HY-P76356-03 100 µg

Gastrokine 1, Human (sf9, His)

Sign In for Pricing
View Details
B7-2 Antibody
orb1326384 100 µg

B7-2 Antibody

Sign In for Pricing
View Details
Recombinant Thermosynechococcus elongatus Photosystem II D2 protein (psbD1)
orb2914928-01 20 µg

Recombinant Thermosynechococcus elongatus Photosystem II D2 protein (psbD1)

Sign In for Pricing
View Details
Recombinant Thermosynechococcus elongatus Photosystem II D2 protein (psbD1)
orb2914928-02 100 µg

Recombinant Thermosynechococcus elongatus Photosystem II D2 protein (psbD1)

Sign In for Pricing
View Details