Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Centruroides suffusus Beta-mammal toxin Css4

Product Specifications

Product Name Alternative

Css IV

Abbreviation

Recombinant Centruroides suffusus Beta-mammal toxin Css4 protein

UniProt

P60266

Expression Region

20-85aa

Organism

Centruroides suffusus suffusus (Mexican scorpion)

Target Sequence

KEGYLVNSYTGCKFECFKLGDNDYCLRECRQQYGKGSGGYCYAFGCWCTHLYEQAVVWPLPNKTCN

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Beta toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing. This toxin is active only on mammals.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Beta toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing. This toxin is active only on mammals.

Molecular Weight

9.6 kDa

References & Citations

"Purification and chemical and biological characterizations of seven toxins from the Mexican scorpion, Centruroides suffusus suffusu.Martin M.-F., Garcia Y., Perez L.G., el Ayeb M., Kopeyan C., Bechis G., Jover E., Rochat H.J. Biol. Chem. 262:4452-4459 (1987)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VPS35 Antibody, Clone 5A9: RPE
MBS8005635-01 0.1 mg

VPS35 Antibody, Clone 5A9: RPE

Sign In for Pricing
View Details
VPS35 Antibody, Clone 5A9: RPE
MBS8005635-02 5x 0.1 mg

VPS35 Antibody, Clone 5A9: RPE

Sign In for Pricing
View Details
Anti-DEXI Antibody Fluoro647 Conjugated
A14587-1-Fluoro647 100 µg/Vial

Anti-DEXI Antibody Fluoro647 Conjugated

Sign In for Pricing
View Details
Wide Mouth Bottle, HDPE, sterile
21601-S 100 PCS/Carton

Wide Mouth Bottle, HDPE, sterile

Sign In for Pricing
View Details
Rat CADM3 Protein (C-His, Rat)
P517819 100 µg

Rat CADM3 Protein (C-His, Rat)

Sign In for Pricing
View Details
Ibrutinib Impurity 53
RM-I182053-01 10 mg

Ibrutinib Impurity 53

Sign In for Pricing
View Details