Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Prostate stem cell antigen (PSCA)

Product Specifications

Product Name Alternative

PSCA; UNQ206/PRO232; Prostate stem cell antigen

Abbreviation

Recombinant Human PSCA protein

Gene Name

PSCA

UniProt

O43653

Expression Region

12-86aa

Organism

Homo sapiens (Human)

Target Sequence

LLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNAS

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Tags & Cell Markers

Relevance

May be involved in the regulation of cell proliferation. Has a cell-proliferation inhibition activity in vitro.1 Publication

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May be involved in the regulation of cell proliferation. Has a cell-proliferation inhibition activity in vitro.

Molecular Weight

9.7 kDa

References & Citations

"Reduced expression of PSCA, a member of the LY-6 family of cell surface antigens, in bladder, esophagus, and stomach tumors."Bahrenberg G., Brauers A., Joost H.G., Jakse G.Biochem. Biophys. Res. Commun. 275:783-788 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDE6G CRISPRa sgRNA lentivector (set of three targets)(Mouse)
36293124 3x 1.0µg DNA

PDE6G CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Rabbit Anti-FAT2 Polyclonal Antibody
PAV1414 100 μL

Rabbit Anti-FAT2 Polyclonal Antibody

Sign In for Pricing
View Details
GPBP1 Protein Lysate (Mouse) with C-HA Tag
22444034 100 µg

GPBP1 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
V9 Mouse IgG2A (L234A/L235A/P329G) ) -Kappa Isotype-control
BP22117302-01 1 mg

V9 Mouse IgG2A (L234A/L235A/P329G) ) -Kappa Isotype-control

Sign In for Pricing
View Details
V9 Mouse IgG2A (L234A/L235A/P329G) ) -Kappa Isotype-control
BP22117302-02 5 mg

V9 Mouse IgG2A (L234A/L235A/P329G) ) -Kappa Isotype-control

Sign In for Pricing
View Details
V9 Mouse IgG2A (L234A/L235A/P329G) ) -Kappa Isotype-control
BP22117302-03 25 mg

V9 Mouse IgG2A (L234A/L235A/P329G) ) -Kappa Isotype-control

Sign In for Pricing
View Details