Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-1 family member 10 (Il1f10)

Product Specifications

Product Name Alternative

Il1f10Interleukin-1 family member 10; IL-1F10

Abbreviation

Recombinant Mouse Il1f10 protein

Gene Name

Il1f10

UniProt

Q8R459

Expression Region

1-152aa

Organism

Mus musculus (Mouse)

Target Sequence

MCSLPMARYYIIKDAHQKALYTRNGQLLLGDPDSDNYSPEKVCILPNRGLDRSKVPIFLGMQGGSCCLACVKTREGPLLQLEDVNIEDLYKGGEQTTRFTFFQRSLGSAFRLEAAACPGWFLCGPAEPQQPVQLTKESEPSTHTEFYFEMSR

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

Cytokine with immunomodulatory activity. Alone, does not induce cytokine production, but reduces IL22 and IL17A production by T-cells in response to heat-killed Candida albicans. Reduces IL36G-induced production of IL8 by peripheral blood mononuclear cells. Increases IL6 production by dendritic cells stimulated by bacterial lipopolysaccharides (LPS) . Ligand for IL-36R/IL1RL2 (By similarity) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Cytokine with immunomodulatory activity. Alone, does not induce cytokine production, but reduces IL22 and IL17A production by T-cells in response to heat-killed Candida albicans. Reduces IL36G-induced production of IL8 by peripheral blood mononuclear cells. Increases IL6 production by dendritic cells stimulated by bacterial lipopolysaccharides (LPS) . Ligand for IL-36R/IL1RL2 (By similarity) .

Molecular Weight

33.1 kDa

References & Citations

"BGEM: an in situ hybridization database of gene expression in the embryonic and adult mouse nervous system."Magdaleno S., Jensen P., Brumwell C.L., Seal A., Lehman K., Asbury A., Cheung T., Cornelius T., Batten D.M., Eden C., Norland S.M., Rice D.S., Dosooye N., Shakya S., Mehta P., Curran T.PLoS Biol. 4:e86-e86 (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Kctd9 shRNA (UAS) - Lentiviral mouse Kctd9 shRNA (UAS, iRFP) (100)
GTR15241695 1 Vial

Lentiviral mouse Kctd9 shRNA (UAS) - Lentiviral mouse Kctd9 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Rabbit anti-SYK Antibody, Affinity Purified
MBS3901120-01 0.01 mg

Rabbit anti-SYK Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-SYK Antibody, Affinity Purified
MBS3901120-02 0.1 mg

Rabbit anti-SYK Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-SYK Antibody, Affinity Purified
MBS3901120-03 5x 0.01 mg

Rabbit anti-SYK Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-SYK Antibody, Affinity Purified
MBS3901120-04 5x 0.1 mg

Rabbit anti-SYK Antibody, Affinity Purified

Sign In for Pricing
View Details
beta-actin Monoclonal Antibody (5B7), AbFluor 594 Conjugated
MBS9525622-01 0.05 mL

beta-actin Monoclonal Antibody (5B7), AbFluor 594 Conjugated

Sign In for Pricing
View Details