Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Acid ceramidase (Asah1), partial

Product Specifications

Product Name Alternative

Acylsphingosine deacylase N-acylsphingosine amidohydrolase

Abbreviation

Recombinant Mouse Asah1 protein, partial

Gene Name

Asah1

UniProt

Q9WV54

Expression Region

19-141aa

Organism

Mus musculus (Mouse)

Target Sequence

QAQDVPPWTEDCRKSTYPPSGPTYRGPVPWHTINLDLPPYKRWHELLAQKAPALRILVNSITSLVNTFVPSGKLMKMVDQKLPGMIGSLPDPFGEEMRGIADVTGIPLGEIISFNIFYELFTM

Tag

N-terminal 10XHis-GST-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Hydrolyzes the sphingolipid ceramide into sphingosine and free fatty acid.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Hydrolyzes the sphingolipid ceramide into sphingosine and free fatty acid.

Molecular Weight

43.8 kDa

References & Citations

"Cloning and characterization of the full-length cDNA and genomic sequences encoding murine acid ceramidase."Li C.-M., Hong S.-B., Kopal G., He X., Linke T., Hou W.-S., Koch J., Gatt S., Sandhoff K., Schuchman E.H.Genomics 50:267-274 (1998)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Phosphotyrosine (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 16F4]
AM00128BT-N 100 µg

Phosphotyrosine (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 16F4]

Ask
View Details
CHTF8 (Chromosome Transmission Fidelity Protein 8 Homolog isoform 2, Decreased Expression in renal and Prostate Cancer Protein, CHTF8, DERPC) (MaxLight 490) discontinued
302355-ML490 100 µL

CHTF8 (Chromosome Transmission Fidelity Protein 8 Homolog isoform 2, Decreased Expression in renal and Prostate Cancer Protein, CHTF8, DERPC) (MaxLight 490) discontinued

Ask
View Details
PP2C (Protein Phosphatase 2C), Bovine discontinued
550771 1 µg

PP2C (Protein Phosphatase 2C), Bovine discontinued

Ask
View Details
CD44 (MDU2, MDU3, MIC4, CD44R, CDw44, IN, HUTCH-I, CSPG8, HCELL, MC56, Pgp1, Epican, LHR, PGP-1, PGP-I, ECMR-III, Hyaluronate receptor, Heparan sulfate proteoglycan, Phagocytic glycoprotein 1, Phagocytic glycoprotein I, chondroitin sulfate proteoglycan 8, Extracellular matrix receptor III, GP90 lymphocyte homing/adhesion receptor, hematopoietic cell E- and L-selectin ligand, CD44 antigen homing function and Indian blood group system) (APC) discontinued
144325-APC 100 µL

CD44 (MDU2, MDU3, MIC4, CD44R, CDw44, IN, HUTCH-I, CSPG8, HCELL, MC56, Pgp1, Epican, LHR, PGP-1, PGP-I, ECMR-III, Hyaluronate receptor, Heparan sulfate proteoglycan, Phagocytic glycoprotein 1, Phagocytic glycoprotein I, chondroitin sulfate proteoglycan 8, Extracellular matrix receptor III, GP90 lymphocyte homing/adhesion receptor, hematopoietic cell E- and L-selectin ligand, CD44 antigen homing function and Indian blood group system) (APC) discontinued

Ask
View Details
Lentiviral human DCHS1 sgRNA gene knockout kit - Lentiviral human DCHS1 sgRNA gene knockout kit (25)
GTR15393351 1 Vial

Lentiviral human DCHS1 sgRNA gene knockout kit - Lentiviral human DCHS1 sgRNA gene knockout kit (25)

Ask
View Details