Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Anemonia sulcata Delta-actitoxin-Avd1c

Product Specifications

Product Name Alternative

ATX-II

Abbreviation

Recombinant Anemonia sulcata Delta-actitoxin-Avd1c protein

UniProt

P01528

Expression Region

1-47aa

Organism

Anemonia sulcata (Mediterranean snakelocks sea anemone)

Target Sequence

GVPCLCDSDGPSVRGNTLSGIIWLAGCPSGWHNCKKHGPTIGWCCKQ

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Relevance

Binds specifically to voltage-gated sodium channels (Nav) (site 3), thereby delaying their inactivation. Has a strong effect on crustaceans and insects (DmNav1) and a weaker effect on mammals. This toxin is highly potent at mammalian Nav1.1/SCN1A (EC (50) =6.01 nM) and Nav1.2/SCN2A (EC (50) =7.88 nM) (PubMed:15169781) . It has also great activity on Nav1.5/SCN5A (EC (50) =49.05 nM), Nav1.4/SCN4A (EC (50) =109.49 nM) and Nav1.6/SCN8A (EC (50) =about 180 nM) and is less potent on Nav1.3/SCN3A (EC (50) =759.22 nM) (when measured as the increase in the slow component) (PubMed:15169781) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Binds specifically to voltage-gated sodium channels (Nav) (site 3), thereby delaying their inactivation. Has a strong effect on crustaceans and insects (DmNav1) and a weaker effect on mammals. This toxin is highly potent at mammalian Nav1.1/SCN1A (EC (50) =6.01 nM) and Nav1.2/SCN2A (EC (50) =7.88 nM)

Molecular Weight

6.9 kDa

References & Citations

"Anemonia sulcata toxins modify activation and inactivation of Na+ currents in a crayfish neurone."Hartung K., Rathmayer W.Pflugers Arch. 404:119-125 (1985)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRIM1 Protein Lysate (Rat) with C-HA Tag
37616036 100 µg

PRIM1 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Ctla4 AAV siRNA Pooled Vector
17068164 1.0 µg

Ctla4 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Celsr2 3'UTR Luciferase Stable Cell Line
TU103708 1.0 mL

Celsr2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Helicobacter Pylori dnaG Protein (aa 1-559)
VAng-Lsx3516-inquire Inquire

Recombinant Helicobacter Pylori dnaG Protein (aa 1-559)

Sign In for Pricing
View Details
Porcine Perforin ELISA kit
GTR10378274 96 Well

Porcine Perforin ELISA kit

Sign In for Pricing
View Details
Sheep Creatine Kinase ELISA kit
GTR10455233 96 Well

Sheep Creatine Kinase ELISA kit

Sign In for Pricing
View Details