Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Clumping factor A (clfA), partial

Product Specifications

Product Name Alternative

Fibrinogen receptor A Fibrinogen-binding protein A

Abbreviation

Recombinant Staphylococcus aureus clfA protein, partial

Gene Name

ClfA

UniProt

Q5HHM8

Expression Region

229-559aa

Organism

Staphylococcus aureus (strain COL)

Target Sequence

GTDITNQLTNVTVGIDSGTTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAGDQVLANGVIDSDGNVIYTFTDYVNTKDDVKATLTMPAYIDPENVKKTGNVTLATGIGSTTANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNTDSNALIDQQNTSIKVYKVDNAADLSESYFVNPENFEDVTNSVNITFPNPNQYKVEFNTPDDQITTPYIVVVNGHIDPNSKGDLALRSTLYGYNSNIIWRSMSWDNEVAFNNGSGSGDGIDKPVVPEQPDEPGEIEPIPE

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Relevance

Cell surface-associated protein implicated in virulence. Promotes bacterial attachment exclusively to the gamma-chain of human fibrinogen. Induces formation of bacterial clumps (By similarity)

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Cell surface-associated protein implicated in virulence. Promotes bacterial attachment exclusively to the gamma-chain of human fibrinogen. Induces formation of bacterial clumps (By similarity) .

Molecular Weight

38 kDa

References & Citations

"Insights on evolution of virulence and resistance from the complete genome analysis of an early methicillin-resistant Staphylococcus aureus strain and a biofilm-producing methicillin-resistant Staphylococcus epidermidis strain."Gill S.R., Fouts D.E., Archer G.L., Mongodin E.F., DeBoy R.T., Ravel J., Paulsen I.T., Kolonay J.F., Brinkac L.M., Beanan M.J., Dodson R.J., Daugherty S.C., Madupu R., Angiuoli S.V., Durkin A.S., Haft D.H., Vamathevan J.J., Khouri H. Fraser C.M.J. Bacteriol. 187:2426-2438 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mycoplasma genitalium Inorganic pyrophosphatase (ppa)
MBS1234605-01 0.02 mg (E-Coli)

Recombinant Mycoplasma genitalium Inorganic pyrophosphatase (ppa)

Sign In for Pricing
View Details
Recombinant Mycoplasma genitalium Inorganic pyrophosphatase (ppa)
MBS1234605-02 0.1 mg (E-Coli)

Recombinant Mycoplasma genitalium Inorganic pyrophosphatase (ppa)

Sign In for Pricing
View Details
Recombinant Mycoplasma genitalium Inorganic pyrophosphatase (ppa)
MBS1234605-03 0.02 mg (Yeast)

Recombinant Mycoplasma genitalium Inorganic pyrophosphatase (ppa)

Sign In for Pricing
View Details
Recombinant Mycoplasma genitalium Inorganic pyrophosphatase (ppa)
MBS1234605-04 0.1 mg (Yeast)

Recombinant Mycoplasma genitalium Inorganic pyrophosphatase (ppa)

Sign In for Pricing
View Details
Recombinant Mycoplasma genitalium Inorganic pyrophosphatase (ppa)
MBS1234605-05 0.02 mg (Baculovirus)

Recombinant Mycoplasma genitalium Inorganic pyrophosphatase (ppa)

Sign In for Pricing
View Details
Recombinant Mycoplasma genitalium Inorganic pyrophosphatase (ppa)
MBS1234605-06 0.02 mg (Mammalian-Cell)

Recombinant Mycoplasma genitalium Inorganic pyrophosphatase (ppa)

Sign In for Pricing
View Details