Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Enteropeptidase (Tmprss15), partial

Product Specifications

Product Name Alternative

Enterokinase Serine protease 7 Transmembrane protease serine 15 Cleaved into the following 2 chains: Enteropeptidase non-catalytic heavy chain Enteropeptidase catalytic light chain

Abbreviation

Recombinant Mouse Tmprss15 protein, partial

Gene Name

Tmprss15

UniProt

P97435

Expression Region

830-1069aa

Organism

Mus musculus (Mouse)

Target Sequence

IVGGSDAQAGAWPWVVALYHRDRSTDRLLCGASLVSSDWLVSAAHCVYRRNLDPTRWTAVLGLHMQSNLTSPQVVRRVVDQIVINPHYDRRRKVNDIAMMHLEFKVNYTDYIQPICLPEENQIFIPGRTCSIAGWGYDKINAGSTVDVLKEADVPLISNEKCQQQLPEYNITESMICAGYEEGGIDSCQGDSGGPLMCQENNRWFLVGVTSFGVQCALPNHPGVYVRVSQFIEWIHSFLH

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

Responsible for initiating activation of pancreatic proteolytic proenzymes (trypsin, chymotrypsin and carboxypeptidase A) . It catalyzes the conversion of trypsinogen to trypsin which in turn activates other proenzymes including chymotrypsinogen, procarboxypeptidases, and proelastases

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Responsible for initiating activation of pancreatic proteolytic proenzymes (trypsin, chymotrypsin and carboxypeptidase A) . It catalyzes the conversion of trypsinogen to trypsin which in turn activates other proenzymes including chymotrypsinogen, procarboxypeptidases, and proelastases (By similarity) .

Molecular Weight

43 kDa

References & Citations

"The amino-terminal sequence of the catalytic subunit of bovine enterokinase."Light A., Janska H.J. Protein Chem. 10:475-480 (1991)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC Anti-Rat CD8a Antibody[OX-8]
E-AB-F1098C-01 50 Tests

FITC Anti-Rat CD8a Antibody[OX-8]

Sign In for Pricing
View Details
FITC Anti-Rat CD8a Antibody[OX-8]
E-AB-F1098C-02 100 Tests

FITC Anti-Rat CD8a Antibody[OX-8]

Sign In for Pricing
View Details
FITC Anti-Rat CD8a Antibody[OX-8]
E-AB-F1098C-03 2x 100 Tests

FITC Anti-Rat CD8a Antibody[OX-8]

Sign In for Pricing
View Details
N3-PEG-SCM (MW 5000)
TCL-01593-01 10 mg

N3-PEG-SCM (MW 5000)

Sign In for Pricing
View Details
N3-PEG-SCM (MW 5000)
TCL-01593-02 50 mg

N3-PEG-SCM (MW 5000)

Sign In for Pricing
View Details
Anti-FAM45A Antibody
CTA4833-01 30 µL

Anti-FAM45A Antibody

Sign In for Pricing
View Details