Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Stromal cell-derived factor 2-like protein 1 (Sdf2l1)

Product Specifications

Product Name Alternative

Sdf2l1; Stromal cell-derived factor 2-like protein 1; SDF2-like protein 1

Abbreviation

Recombinant Mouse Sdf2l1 protein

Gene Name

Sdf2l1

UniProt

Q9ESP1

Expression Region

29-211aa

Organism

Mus musculus (Mouse)

Target Sequence

SKASAGLVTCGSVLKLLNTHHKVRLHSHDIKYGSGSGQQSVTGVEESDDANSYWRIRGGSEGGCPRGLPVRCGQAVRLTHVLTGKNLHTHHFPSPLSNNQEVSAFGEDGEGDDLDLWTVRCSGQHWEREASVRFQHVGTSVFLSVTGEQYGNPIRGQHEVHGMPSANAHNTWKAMEGIFIKPGADLSTGHDEL

Tag

N-terminal 6xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

24.4 kDa

References & Citations

"Murine and human SDF2L1 is an endoplasmic reticulum stress-inducible gene and encodes a new member of the Pmt/rt protein family." Fukuda S., Sumii M., Masuda Y., Takahashi M., Koike N., Teishima J., Yasumoto H., Itamoto T., Asahara T., Dohi K., Kamiya Biochem. Biophys. Res. Commun. 280:407-414 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Liver
CR561877 5 µg

Tissue Total RNA, Liver

Sign In for Pricing
View Details
EDG8 (S1PR5) Rabbit Polyclonal Antibody
TA381228 100 µL

EDG8 (S1PR5) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
KRTAP7-1 (NM_181606) Human Over-expression Lysate
LY430550 100 µg

KRTAP7-1 (NM_181606) Human Over-expression Lysate

Sign In for Pricing
View Details
Neurogranin (NRGN) (NM_001126181) Human Over-expression Lysate
LC426667 20 µg

Neurogranin (NRGN) (NM_001126181) Human Over-expression Lysate

Sign In for Pricing
View Details
SCOC (NM_001153446) Human Over-expression Lysate
LC431758 20 µg

SCOC (NM_001153446) Human Over-expression Lysate

Sign In for Pricing
View Details
TIFA Human Gene Knockout Kit (CRISPR)
KN204357RB 1 Kit

TIFA Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details