Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Marmota monax Tumor necrosis factor (TNF), partial

Product Specifications

Product Name Alternative

(Cachectin) (TNF-alpha) (Tumor necrosis factor ligand superfamily member 2) (TNF-a)

Abbreviation

Recombinant Marmota monax TNF protein, partial

Gene Name

TNF

UniProt

O35734

Expression Region

57-233aa

Organism

Marmota monax (Woodchuck)

Target Sequence

GPQREEFLNNLPLSPQAQMLTLRSSSQNMNDKPVAHVVAKNEDKEQLVWLSRRANALLANGMELIDNQLVVPANGLYLVYSQVLFKGQGCPSYVLLTHTVSRFAVSYQDKVNLLSAIKSPCPKESLEGAEFKPWYEPIYLGGVFELQKGDRLSAEVNLPSYLDFAESGQVYFGVIAL

Tag

N-terminal 6xHis-B2M-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Immunology

Relevance

Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation . Induces insulin resistance in adipocytes via inhibition of insulin-induced IRS1 tyrosine phosphorylation and insulin-induced glucose uptake. Induces GKAP42 protein degradation in adipocytes which is partially responsible for TNF-induced insulin resistance . Plays a role in angiogenesis by inducing VEGF production synergistically with IL1B and IL6 . The TNF intracellular domain (ICD) form induces IL12 production in dendritic cells.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

34.2 kDa

References & Citations

"Woodchuck lymphotoxin-alpha, -beta and tumor necrosis factor genes: structure, characterization and biological activity." Li D.H., Havell E.A., Brown C.L., Cullen J.M. Gene 242:295-305 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3,5-Di-tert-butyl-4-hydroxyphenylpropionic Acid
TRC-D417555-5G 5 g

3,5-Di-tert-butyl-4-hydroxyphenylpropionic Acid

Sign In for Pricing
View Details
Recombinant ADSL/Adenylosuccinate Lyase Monoclonal Antibody
AN300398P 100 µL

Recombinant ADSL/Adenylosuccinate Lyase Monoclonal Antibody

Sign In for Pricing
View Details
CD61 / Integrin '3 / Platelet Glycoprotein IIIa (Platelet Marker) (rITGB3/2145), CF405S conjugate, 0.1mg/mL
BNC043645-500 1x 500 µL

CD61 / Integrin '3 / Platelet Glycoprotein IIIa (Platelet Marker) (rITGB3/2145), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
N-Nitrosodipropylamine
TRC-N525480-25G 25 g

N-Nitrosodipropylamine

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS503699 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
Hexylene Glycol
TRC-H295870-50G 50 g

Hexylene Glycol

Sign In for Pricing
View Details