Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Selenoprotein M (SELENOM)

Product Specifications

Product Name Alternative

SELENOM; SELM; Selenoprotein M; SelM

Abbreviation

Recombinant Human SELENOM protein

Gene Name

SELENOM

UniProt

Q8WWX9

Expression Region

24-145aa

Organism

Homo sapiens (Human)

Target Sequence

ATAYRPDWNRLSGLTRARVETCGGSQLNRLKEVKAFVTQDIPFYHNLVMKHLPGADPELVLLGRRYEELERIPLSEMTREEINALVQELGFYRKAAPDAQVPPEYVWAPAKPPEETSDHADL

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

May function as a thiol-disulfide oxidoreductase that participates in disulfide bond formation.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May function as a thiol-disulfide oxidoreductase that participates in disulfide bond formation.

Molecular Weight

17.9 kDa

References & Citations

"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC) ."The MGC Project Team Genome Res. 14:2121-2127 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCMV-FRT-To-ADAM9-2xFLAG-Hyg Plasmid
PVT66151 2 µg

PCMV-FRT-To-ADAM9-2xFLAG-Hyg Plasmid

Sign In for Pricing
View Details
Rat factor B (BF) ELISA Kit
QY-E11606 96 Tests

Rat factor B (BF) ELISA Kit

Sign In for Pricing
View Details
MRPL42 (NM_172178) Human Tagged ORF Clone
RC219347 10 µg

MRPL42 (NM_172178) Human Tagged ORF Clone

Sign In for Pricing
View Details
CD4 (CD4 Antigen, CD4 Molecule, CD4mut, T Cell Surface Antigen T4/Leu3, T Cell Surface Glycoprotein CD4) (Biotin)
367090 100 µg

CD4 (CD4 Antigen, CD4 Molecule, CD4mut, T Cell Surface Antigen T4/Leu3, T Cell Surface Glycoprotein CD4) (Biotin)

Sign In for Pricing
View Details
Lgals4 Antibody - C-terminal region
ARP42280_P050-25UL 25 µL

Lgals4 Antibody - C-terminal region

Sign In for Pricing
View Details
ZNF232 (Zinc Finger Protein 232, Zinc Finger and SCAN Domain-containing Protein 11, ZSCAN11) (MaxLight 490)
MBS6399091-01 0.1 mL

ZNF232 (Zinc Finger Protein 232, Zinc Finger and SCAN Domain-containing Protein 11, ZSCAN11) (MaxLight 490)

Sign In for Pricing
View Details