Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Coiled-coil domain-containing protein 3 (CCDC3)

Product Specifications

Product Name Alternative

Fat/vessel-derived secretory protein Short name: Favine

Abbreviation

Recombinant Human CCDC3 protein

Gene Name

CCDC3

UniProt

Q9BQI4

Expression Region

22-270aa

Organism

Homo sapiens (Human)

Target Sequence

CQLPSEWRPLSEGCRAELAETIVYARVLALHPEAPGLYNHLPWQYHAGQGGLFYSAEVEMLCDQAWGSMLEVPAGSRLNLTGLGYFSCHSHTVVQDYSYFFFLRMDENYNLLPHGVNFQDAIFPDTQENRRMFSSLFQFSNCSQGQQLATFSSDWEIQEDSRLMCSSVQKALFEEEDHVKKLQQKVATLEKRNRQLRERVKKVKRSLRQARKKGRHLELANQKLSEKLAAGALPHINARGPVRPPYLRG

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Negatively regulates TNF-alpha-induced pro-inflammatory response in endothelial cells (ECs) via inhibition of TNF-alpha-induced NF-kappaB activation in ECs

Molecular Weight

32.1 kDa

References & Citations

"The DNA sequence and comparative analysis of human chromosome 10."Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J. Rogers J.Nature 429:375-381 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNFSF14 Antibody
KC-1325-01 50 μL

TNFSF14 Antibody

Sign In for Pricing
View Details
TNFSF14 Antibody
KC-1325-02 100 µL

TNFSF14 Antibody

Sign In for Pricing
View Details
TNFSF14 Antibody
KC-1325-03 1 mL

TNFSF14 Antibody

Sign In for Pricing
View Details
2-[3-(Aminosulfonyl)-4-chlorobenzoyl]-benzonic Acid
TRC-A633000-250MG 250 mg

2-[3-(Aminosulfonyl)-4-chlorobenzoyl]-benzonic Acid

Sign In for Pricing
View Details
Human Peroxisome Proliferator Activated Receptor Gamma Coactivator 1 Alpha (PPARgC1a) ELISA Kit
RDR-PPARgC1a-Hu-01 96 Tests

Human Peroxisome Proliferator Activated Receptor Gamma Coactivator 1 Alpha (PPARgC1a) ELISA Kit

Sign In for Pricing
View Details
Human Peroxisome Proliferator Activated Receptor Gamma Coactivator 1 Alpha (PPARgC1a) ELISA Kit
RDR-PPARgC1a-Hu-02 48 Tests

Human Peroxisome Proliferator Activated Receptor Gamma Coactivator 1 Alpha (PPARgC1a) ELISA Kit

Sign In for Pricing
View Details