Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Osmotin-like protein OSM34 (OSM34)

Product Specifications

Product Name Alternative

OSL3_ARATH; OSM34; Osmotin-like protein OSM34

Abbreviation

Recombinant Mouse-ear cress OSM34 protein

Gene Name

OSM34

UniProt

P50700

Expression Region

23-244aa

Organism

Arabidopsis thaliana (Mouse-ear cress)

Target Sequence

ATFEILNQCSYTVWAAASPGGGRRLDAGQSWRLDVAAGTKMARIWGRTNCNFDSSGRGRCQTGDCSGGLQCTGWGQPPNTLAEYALNQFNNLDFYDISLVDGFNIPMEFSPTSSNCHRILCTADINGQCPNVLRAPGGCNNPCTVFQTNQYCCTNGQGSCSDTEYSRFFKQRCPDAYSYPQDDPTSTFTCTNTNYRVVFCPRSRLGATGSHQLPIKMVTEEN

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

44.4 kDa

References & Citations

"Sequence and analysis of chromosome 4 of the plant Arabidopsis thaliana."Mayer K.F.X., Schueller C., Wambutt R., Murphy G., Volckaert G., Pohl T., Duesterhoeft A., Stiekema W., Entian K.-D., Terryn N., Harris B., Ansorge W., Brandt P., Grivell L.A., Rieger M., Weichselgartner M., de Simone V., Obermaier B. McCombie W.R.Nature 402:769-777 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Isoform 2

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Aedes aegypti Enhancer of rudimentary homolog
MBS1368816-01 0.02 mg (E-Coli)

Recombinant Aedes aegypti Enhancer of rudimentary homolog

Sign In for Pricing
View Details
Recombinant Aedes aegypti Enhancer of rudimentary homolog
MBS1368816-02 0.1 mg (E-Coli)

Recombinant Aedes aegypti Enhancer of rudimentary homolog

Sign In for Pricing
View Details
Recombinant Aedes aegypti Enhancer of rudimentary homolog
MBS1368816-03 0.02 mg (Yeast)

Recombinant Aedes aegypti Enhancer of rudimentary homolog

Sign In for Pricing
View Details
Recombinant Aedes aegypti Enhancer of rudimentary homolog
MBS1368816-04 0.1 mg (Yeast)

Recombinant Aedes aegypti Enhancer of rudimentary homolog

Sign In for Pricing
View Details
Recombinant Aedes aegypti Enhancer of rudimentary homolog
MBS1368816-05 0.02 mg (Baculovirus)

Recombinant Aedes aegypti Enhancer of rudimentary homolog

Sign In for Pricing
View Details
Recombinant Aedes aegypti Enhancer of rudimentary homolog
MBS1368816-06 1 mg (E-Coli)

Recombinant Aedes aegypti Enhancer of rudimentary homolog

Sign In for Pricing
View Details