Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Horse Major allergen Equ c 1

Product Specifications

Product Name Alternative

Allergen: Equ c 1

Abbreviation

Recombinant Horse Major allergen Equ c 1 protein

UniProt

Q95182

Expression Region

16-187aa

Organism

Equus caballus (Horse)

Target Sequence

QQEENSDVAIRNFDISKISGEWYSIFLASDVKEKIEENGSMRVFVDVIRALDNSSLYAEYQTKVNGECTEFPMVFDKTEEDGVYSLNYDGYNVFRISEFENDEHIILYLVNFDKDRPFQLFEFYAREPDVSPEIKEEFVKIVQKRGIVKENIIDLTKIDRCFQLRGNGVAQA

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Allergen

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

22.1 kDa

References & Citations

"Biochemical characterization and surfactant properties of horse allergens."Goubran Botros H., Poncet P., Rabillon J., Fontaine T., Laval J.-M., David B.Eur. J. Biochem. 268:3126-3136 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human CD69 Antibody (SAA0819), APC
HC273237-01 1 Each

Anti-Human CD69 Antibody (SAA0819), APC

Sign In for Pricing
View Details
Anti-Human CD69 Antibody (SAA0819), APC
HC273237-02 100 Tests

Anti-Human CD69 Antibody (SAA0819), APC

Sign In for Pricing
View Details
ZNF519 Human siRNA Oligo Duplex (Locus ID 162655)
SR316043 1 Kit

ZNF519 Human siRNA Oligo Duplex (Locus ID 162655)

Sign In for Pricing
View Details
CXorf49B Protein Vector (Human) (pPM-C-His)
PV071524 500 ng

CXorf49B Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Recombinant Human C1qTNF9 CF
6537-TN-050 50 µg

Recombinant Human C1qTNF9 CF

Sign In for Pricing
View Details
PDE1B (NM_000924) Human Recombinant Protein
TP306588L 1 mg

PDE1B (NM_000924) Human Recombinant Protein

Sign In for Pricing
View Details