Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Legumain (Lgmn)

Product Specifications

Product Name Alternative

Asparaginyl endopeptidase Protease, cysteine 1

Abbreviation

Recombinant Mouse Lgmn protein

Gene Name

Lgmn

UniProt

O89017

Expression Region

18-325aa

Organism

Mus musculus (Mouse)

Target Sequence

VPVGVDDPEDGGKHWVVIVAGSNGWYNYRHQADACHAYQIIHRNGIPDEQIIVMMYDDIANSEENPTPGVVINRPNGTDVYKGVLKDYTGEDVTPENFLAVLRGDAEAVKGKGSGKVLKSGPRDHVFIYFTDHGATGILVFPNDDLHVKDLNKTIRYMYEHKMYQKMVFYIEACESGSMMNHLPDDINVYATTAANPKESSYACYYDEERGTYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHTNTSHVMQYGNKSISTMKVMQFQGMKHRASSPISLPPVTHLDLTPSPDVPLTILKRKLLRTN

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Immunology

Relevance

Has a strict specificity for hydrolysis of asparaginyl bonds. Can also cleave aspartyl bonds slowly, especially under acidic conditions. May be involved in the processing of proteins for MHC class II antigen presentation in the lysosomal/endosomal system. Required for normal lysosomal protein degradation in renal proximal tubules. Required for normal degradation of internalized EGFR. Plays a role in the regulation of cell proliferation via its role in EGFR degradation.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Has a strict specificity for hydrolysis of asparaginyl bonds. Can also cleave aspartyl bonds slowly, especially under acidic conditions. May be involved in the processing of proteins for MHC class II antigen presentation in the lysosomal/endosomal system. Required for normal lysosomal protein degradation in renal proximal tubules. Required for normal degradation of internalized EGFR. Plays a role in the regulation of cell proliferation via its role in EGFR degradation.

Molecular Weight

36.8 kDa

References & Citations

"Autocatalytic activation of human legumain at aspartic acid residues."Halfon S., Patel S., Vega F., Zurawski S., Zurawski G.FEBS Lett. 438:114-118 (1998)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biliverdin Reductase (BLVRA) Rabbit Polyclonal Antibody
TA365522 100 µL

Biliverdin Reductase (BLVRA) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LUC7L (NM_018032) Human Over-expression Lysate
LC429566 20 µg

LUC7L (NM_018032) Human Over-expression Lysate

Sign In for Pricing
View Details
D-erythro-Sphingosine-13C2,D2
TRC-S681002-1MG 1 mg

D-erythro-Sphingosine-13C2,D2

Sign In for Pricing
View Details
Anti-Mouse CD90 (HK2.1) In Vivo Antibody - Low Endotoxin
ICH1065-25mg 25 mg

Anti-Mouse CD90 (HK2.1) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details
Ethyl N-Cyanoethanimidoate
TRC-B124878-1G 1 g

Ethyl N-Cyanoethanimidoate

Sign In for Pricing
View Details
Human FETUA Antibody Pair Set
E-KAB-0178 50 µL & 100 µg

Human FETUA Antibody Pair Set

Sign In for Pricing
View Details