Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Peptide methionine sulfoxide reductase B7 (MSRB7)

Product Specifications

Product Name Alternative

Peptide-methionine (R) -S-oxide reductase

Abbreviation

Recombinant Mouse-ear cress MSRB7 protein

Gene Name

MSRB7

UniProt

Q8VY86

Expression Region

1-144aa

Organism

Arabidopsis thaliana (Mouse-ear cress)

Target Sequence

MAAMTAAAVPATGSFQKQDEEWRAVLSPEQFRVLRLKGTDKRGKGEFTKKFEEGTYSCAGCGTALYKSTTKFDSGCGWPAFFDAIPGAIKQTPEAGGRRMEITCAVCDGHLGHVFKGEGYSTPTDQRHCVNSVSLKFSSAGSSQ

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Catalyzes the reduction of methionine sulfoxide (MetSO) to methionine in proteins. Plays a protective role against oxidative stress by restoring activity to proteins that have been inactivated by methionine oxidation. MSRB family specifically reduces the MetSO R-enantiomer (By similarity) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Catalyzes the reduction of methionine sulfoxide (MetSO) to methionine in proteins. Plays a protective role against oxidative stress by restoring activity to proteins that have been inactivated by methionine oxidation. MSRB family specifically reduces the MetSO R-enantiomer (By similarity) .

Molecular Weight

31.5 kDa

References & Citations

"Sequence and analysis of chromosome 4 of the plant Arabidopsis thaliana."Mayer K.F.X., Schueller C., Wambutt R., Murphy G., Volckaert G., Pohl T., Duesterhoeft A., Stiekema W., Entian K.-D., Terryn N., Harris B., Ansorge W., Brandt P., Grivell L.A., Rieger M., Weichselgartner M., de Simone V., Obermaier B. McCombie W.R.Nature 402:769-777 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTP4A3 Rabbit pAb
MBS8544733-01 0.1 mL

PTP4A3 Rabbit pAb

Sign In for Pricing
View Details
PTP4A3 Rabbit pAb
MBS8544733-02 0.1 mL (AF405L)

PTP4A3 Rabbit pAb

Sign In for Pricing
View Details
PTP4A3 Rabbit pAb
MBS8544733-03 0.1 mL (AF405S)

PTP4A3 Rabbit pAb

Sign In for Pricing
View Details
PTP4A3 Rabbit pAb
MBS8544733-04 0.1 mL (AF610)

PTP4A3 Rabbit pAb

Sign In for Pricing
View Details
PTP4A3 Rabbit pAb
MBS8544733-05 0.1 mL (AF635)

PTP4A3 Rabbit pAb

Sign In for Pricing
View Details
PTP4A3 Rabbit pAb
MBS8544733-06 0.1 mL (APC)

PTP4A3 Rabbit pAb

Sign In for Pricing
View Details