Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Fibroblast growth factor 15 (Fgf15)

Product Specifications

Product Name Alternative

Short name:FGF-15

Abbreviation

Recombinant Mouse Fgf15 protein

Gene Name

Fgf15

UniProt

O35622

Expression Region

26-218aa

Organism

Mus musculus (Mouse)

Target Sequence

RPLAQQSQSVSDEDPLFLYGWGKITRLQYLYSAGPYVSNCFLRIRSDGSVDCEEDQNERNLLEFRAVALKTIAIKDVSSVRYLCMSADGKIYGLIRYSEEDCTFREEMDCLGYNQYRSMKHHLHIIFIQAKPREQLQDQKPSNFIPVFHRSFFETGDQLRSKMFSLPLESDSMDPFRMVEDVDHLVKSPSFQK

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Involved in the suppression of bile acid biosynthesis through down-regulation of CYP7A1 expression.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Involved in the suppression of bile acid biosynthesis through down-regulation of CYP7A1 expression.

Molecular Weight

38.5 kDa

References & Citations

"The transcriptional landscape of the mammalian genome."Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MOB1A Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV680725 1.0 µg DNA

MOB1A Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
RHOBTB2 (DBC2, KIAA0717, Rho-related BTB Domain-containing Protein 2, Deleted in Breast Cancer 2 Gene Protein, p83) (FITC)
132556-FITC 100 µL

RHOBTB2 (DBC2, KIAA0717, Rho-related BTB Domain-containing Protein 2, Deleted in Breast Cancer 2 Gene Protein, p83) (FITC)

Sign In for Pricing
View Details
MGLL Antibody
C48702-01 50 μL

MGLL Antibody

Sign In for Pricing
View Details
MGLL Antibody
C48702-02 100 µL

MGLL Antibody

Sign In for Pricing
View Details
Histone H1.3 (HIST1H1D) Antibody
abx343164-01 20 µL

Histone H1.3 (HIST1H1D) Antibody

Sign In for Pricing
View Details
Histone H1.3 (HIST1H1D) Antibody
abx343164-02 50 µL

Histone H1.3 (HIST1H1D) Antibody

Sign In for Pricing
View Details