Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human cytomegalovirus Uncharacterized protein UL128 (UL128)

Product Specifications

Product Name Alternative

UL128Uncharacterized protein UL128

Abbreviation

Recombinant Human cytomegalovirus Uncharacterized protein UL128

Gene Name

UL128

UniProt

P16837

Expression Region

1-171aa

Organism

Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5)

Target Sequence

MSPKDLTPFLTTLWLLLGHSRVPRVRAEECCEFINVNHPPERCYDFKMCNRFTVALRCPDGEVCYSPEKTAEIRGIVTTMTHSLTRQVVHNKLTSCNYNPLYLEADGRIRCGKVNDKAQYLLGAAGSVPYRWINLEYDKITRIVGLDQYLESVKKHKRLDVCRAKMGYMLQ

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Microbiology

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

21.7 kDa

References & Citations

"The human cytomegalovirus genome revisited: comparison with the chimpanzee cytomegalovirus genome."Davison A.J., Dolan A., Akter P., Addison C., Dargan D.J., Alcendor D.J., McGeoch D.J., Hayward G.S.J. Gen. Virol. 84:17-28 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RN5S160 Recombinant Protein (Human)
RP087135 100 µg

RN5S160 Recombinant Protein (Human)

Sign In for Pricing
View Details
Phospho-CHEK2 (Thr387) Polyclonal Antibody, Cy3 Conjugated
bs-5275R-Cy3 100 µL

Phospho-CHEK2 (Thr387) Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
KYNU Antibody
E30AC2160 100 µL

KYNU Antibody

Sign In for Pricing
View Details
Edrf1 (NM_001107557) Rat Tagged ORF Clone
RR205614 10 µg

Edrf1 (NM_001107557) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Rat Cytochrome P450 2B6 (CYP2B6) ELISA Kit
YLA0143RA-01 48 Tests

Rat Cytochrome P450 2B6 (CYP2B6) ELISA Kit

Sign In for Pricing
View Details
Rat Cytochrome P450 2B6 (CYP2B6) ELISA Kit
YLA0143RA-02 96 Tests

Rat Cytochrome P450 2B6 (CYP2B6) ELISA Kit

Sign In for Pricing
View Details