Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serratia marcescens Hemophore HasA (hasA)

Product Specifications

Product Name Alternative

Heme acquisition system protein A

Abbreviation

Recombinant Serratia marcescens hasA protein

Gene Name

HasA

UniProt

Q54450

Expression Region

1-188aa

Organism

Serratia marcescens

Target Sequence

MAFSVNYDSSFGGYSIHDYLGQWASTFGDVNHTNGNVTDANSGGFYGGSLSGSQYAISSTANQVTAFVAGGNLTYTLFNEPAHTLYGQLDSLSFGDGLSGGDTSPYSIQVPDVSFGGLNLSSLQAQGHDGVVHQVVYGLMSGDTGALETALNGILDDYGLSVNSTFDQVAAATAVGVQHADSPELLAA

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Microbiology

Relevance

Can bind free heme and also acquire it from hemoglobin. Conveys heme from hemoglobin to the HasR receptor which releases it into the bacterium. HasR alone can take up heme but the synergy between HasA and HasR increases heme uptake 100-fold.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Can bind free heme and also acquire it from hemoglobin. Conveys heme from hemoglobin to the HasR receptor which releases it into the bacterium. HasR alone can take up heme but the synergy between HasA and HasR increases heme uptake 100-fold.

Molecular Weight

35.3 kDa

References & Citations

"Iron acquisition from heme and hemoglobin by a Serratia marcescens Extracellular domain protein."Letoffe S., Ghigo J.-M., Wandersman C.Proc. Natl. Acad. Sci. U.S.A. 91:9876-9880 (1994)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ADAM33 activation kit by CRISPRa
GA112930 1 Kit

Human ADAM33 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Human CD47/IAP Protein (mFc Tag)
PDMH100022-01 20 µg

Recombinant Human CD47/IAP Protein (mFc Tag)

Sign In for Pricing
View Details
Recombinant Human CD47/IAP Protein (mFc Tag)
PDMH100022-02 100 µg

Recombinant Human CD47/IAP Protein (mFc Tag)

Sign In for Pricing
View Details
Recombinant Human CD47/IAP Protein (mFc Tag)
PDMH100022-03 500 µg

Recombinant Human CD47/IAP Protein (mFc Tag)

Sign In for Pricing
View Details
Recombinant Human CD47/IAP Protein (mFc Tag)
PDMH100022-04 1 mg

Recombinant Human CD47/IAP Protein (mFc Tag)

Sign In for Pricing
View Details
DHX36 (NM_020865) Human Recombinant Protein
TP323929M 100 µg

DHX36 (NM_020865) Human Recombinant Protein

Sign In for Pricing
View Details