Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus 30 kDa neutral phosphatase, partial

Product Specifications

Product Name Alternative

Short name:NPTase

Abbreviation

Recombinant Staphylococcus aureus 30 kDa neutral phosphatase protein, partial

UniProt

P21222

Expression Region

1-35aa

Organism

Staphylococcus aureus

Target Sequence

KSSAEVQQTQQASIPASQKANLGNQNNIMSVASYQ

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Microbiology

Relevance

Highly cationic enzyme that can bind human or rat immunoglobulins as well as serum albumin, and could therefore be involved in post-infectious sequelae.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Highly cationic enzyme that can bind human or rat immunoglobulins as well as serum albumin, and could therefore be involved in post-infectious sequelae.

Molecular Weight

19.7 kDa

References & Citations

"Staphylococcal neutral phosphatase. A highly cationic molecule with binding properties for immunoglobulin."Yousif Y., Schiltz E., Okada K., Batsford S., Vogt A.APMIS 102:891-900 (1994)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human GNPDA 1 AssayLite™ Antibody (FITC Conjugate)
32011-05141 2x 75 µg

Human GNPDA 1 AssayLite™ Antibody (FITC Conjugate)

Sign In for Pricing
View Details
NEK7 Blocking Peptide
CBP7227-01 1 mg

NEK7 Blocking Peptide

Sign In for Pricing
View Details
NEK7 Blocking Peptide
CBP7227-02 5 mg

NEK7 Blocking Peptide

Sign In for Pricing
View Details
ROCK1 Antibody Blocking Peptide
orb73177 500 µg

ROCK1 Antibody Blocking Peptide

Sign In for Pricing
View Details
SP100 Antibody - middle region
ARP88106_P050-25UL 25 µL

SP100 Antibody - middle region

Sign In for Pricing
View Details
Anti-ROR1 (zilovertamab biosimilar) mAb
E33B100073 50 µg

Anti-ROR1 (zilovertamab biosimilar) mAb

Sign In for Pricing
View Details