Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Proliferation marker protein Ki-67 (MKI67), partial

Product Specifications

Product Name Alternative

Antigen identified by monoclonal Ki 67 ; Antigen identified by monoclonal Ki-67; Antigen KI-67; Antigen KI67 ; Antigen Ki67; KI67_HUMAN; KIA; Marker of proliferation Ki-67; MIB 1; MIB; MKI67; PPP1R105; Proliferation marker protein Ki-67; Proliferation related Ki 67 antigen ; Protein phosphatase 1 regulatory subunit 105; RP11-380J17.2

Abbreviation

Recombinant Human MKI67 protein, partial

Gene Name

MKI67

UniProt

P46013

Expression Region

3120-3256aa

Organism

Homo sapiens (Human)

Target Sequence

NEKKPMKTSPEMDIQNPDDGARKPIPRDKVTENKRCLRSARQNESSQPKVAEESGGQKSAKVLMQNQKGKGEAGNSDSMCLRSRKTKSQPAASTLESKSVQRVTRSVKRCAENPKKAEDNVCVKKIRTRSHRDSEDI

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Thought to be required for maintaining cell proliferation.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Required to maintain individual mitotic chromosomes dispersed in the cytoplasm following nuclear envelope disassembly

Molecular Weight

19.4 kDa

References & Citations

"The cell proliferation-associated antigen of antibody Ki-67: a very large, ubiquitous nuclear protein with numerous repeated elements, representing a new kind of cell cycle-maintaining proteins."Schlueter C., Duchrow M., Wohlenberg C., Becker M.H.G., Key G., Flad H.-D., Gerdes J.J. Cell Biol. 123:513-522 (1993)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C2orf53 (PRR30) activation kit by CRISPRa
GA117443 1 Kit

Human C2orf53 (PRR30) activation kit by CRISPRa

Sign In for Pricing
View Details
BHC, mixture of isomers (a:b:gamma:delta=1:1:1:1)
TRC-B372008-50MG 50 mg

BHC, mixture of isomers (a:b:gamma:delta=1:1:1:1)

Sign In for Pricing
View Details
Frozen Tissue Sections, Cervix
CS642051 5x 5 µm

Frozen Tissue Sections, Cervix

Sign In for Pricing
View Details
Slc23a3 Mouse Gene Knockout Kit (CRISPR)
KN515948 1 Kit

Slc23a3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Sabatolimab Biosimilar - Research Grade
ICH5079-10mg 10 mg (2x 5 mg)

Sabatolimab Biosimilar - Research Grade

Sign In for Pricing
View Details
TIMP1 (Marker of Lymph Node Metastasis) (2A5), CF594 conjugate, 0.1mg/mL
BNC941648-100 1x 100 µL

TIMP1 (Marker of Lymph Node Metastasis) (2A5), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details