Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Aspergillus niger Aspergillopepsin-2, partial

Product Specifications

Product Name Alternative

Acid protease A Aspergillopepsin II Proctase A

Abbreviation

Recombinant Aspergillus niger Aspergillopepsin-2 protein, partial

UniProt

P24665

Expression Region

60-98aa

Organism

Aspergillus niger

Target Sequence

EEYSSNWAGAVLIGDGYTKVTGEFTVPSVSAGSSGSSGY

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Microbiology

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.9 kDa

References & Citations

"The gene and deduced protein sequences of the zymogen of Aspergillus niger acid proteinase A."Inoue H., Kimura T., Makabe O., Takahashi K.J. Biol. Chem. 266:19484-19489 (1991)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF25 sgRNA CRISPR Lentivector (Human) (Target 1)
K2681902 1.0 µg DNA

ZNF25 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
PAN2 Polyclonal Conjugated Antibody
C28934 100 µL

PAN2 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Nkx2-5 (Homeobox Protein Nkx-25, Cardiac-specific Homeobox, Homeobox Protein CSX, Homeobox Protein NK-2 Homolog E, Nkx2-5, Csx, Nkx-25, Nkx2e) (MaxLight 405) discontinued
302601-ML405 200 µL

Nkx2-5 (Homeobox Protein Nkx-25, Cardiac-specific Homeobox, Homeobox Protein CSX, Homeobox Protein NK-2 Homolog E, Nkx2-5, Csx, Nkx-25, Nkx2e) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Valyl-tRNA Synthetase, NT (G7A, Protein G7a, Valine-tRNA ligase, ValRS, VARS1, VARS2) (APC)
MBS6505455-01 0.2 mL

Valyl-tRNA Synthetase, NT (G7A, Protein G7a, Valine-tRNA ligase, ValRS, VARS1, VARS2) (APC)

Sign In for Pricing
View Details
Valyl-tRNA Synthetase, NT (G7A, Protein G7a, Valine-tRNA ligase, ValRS, VARS1, VARS2) (APC)
MBS6505455-02 5x 0.2 mL

Valyl-tRNA Synthetase, NT (G7A, Protein G7a, Valine-tRNA ligase, ValRS, VARS1, VARS2) (APC)

Sign In for Pricing
View Details
Rabbit Polyclonal TEL2 Antibody
NBP1-81762-25ul 25 µL

Rabbit Polyclonal TEL2 Antibody

Sign In for Pricing
View Details