Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlamydia trachomatis Small cysteine-rich outer membrane protein OmcA (OmcA)

Product Specifications

Product Name Alternative

9KDA cysteine-rich lipoprotein Short name:9KDA-CRP

Abbreviation

Recombinant Chlamydia trachomatis omcA protein

Gene Name

OmcA

UniProt

P0CC05

Expression Region

19-88aa

Organism

Chlamydia trachomatis (strain D/UW-3/Cx)

Target Sequence

CCRIVDCCFEDPCAPIQCSPCESKKKDVDGGCNSCNGYVPACKPCGGDTHQDAKHGPQARGIPVDGKCRQ

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Microbiology

Relevance

In elementary bodies (EBs, the infectious stage, which is able to survive outside the host cell) provides the structural integrity of the outer envelope through disulfide cross-links with the large cysteine-rich periplasmic protein and the major outer membrane porin. It has been described in publications as the Sarkosyl-insoluble COMC (Chlamydia outer membrane complex), and serves as the functional equivalent of peptidoglycan (By similarity) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

In elementary bodies (EBs, the infectious stage, which is able to survive outside the host cell) provides the structural integrity of the outer envelope through disulfide cross-links with the large cysteine-rich periplasmic protein and the major outer membrane porin. It has been described in publications as the Sarkosyl-insoluble COMC (Chlamydia outer membrane complex), and serves as the functional equivalent of peptidoglycan (By similarity) .

Molecular Weight

23.4 kDa

References & Citations

"Cysteine-rich outer membrane proteins of Chlamydia trachomatis display compensatory sequence changes between biovariants."Allen J.E., Cerrone M.C., Beatty P.R., Stephens R.S.Mol. Microbiol. 4:1543-1550 (1990)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Brucella ovis Imidazole glycerol phosphate synthase subunit HisF (hisF)
MBS1230208-01 0.02 mg (E-Coli)

Recombinant Brucella ovis Imidazole glycerol phosphate synthase subunit HisF (hisF)

Ask
View Details
Recombinant Brucella ovis Imidazole glycerol phosphate synthase subunit HisF (hisF)
MBS1230208-02 0.02 mg (Yeast)

Recombinant Brucella ovis Imidazole glycerol phosphate synthase subunit HisF (hisF)

Ask
View Details
Recombinant Brucella ovis Imidazole glycerol phosphate synthase subunit HisF (hisF)
MBS1230208-03 0.1 mg (E-Coli)

Recombinant Brucella ovis Imidazole glycerol phosphate synthase subunit HisF (hisF)

Ask
View Details
Recombinant Brucella ovis Imidazole glycerol phosphate synthase subunit HisF (hisF)
MBS1230208-04 0.1 mg (Yeast)

Recombinant Brucella ovis Imidazole glycerol phosphate synthase subunit HisF (hisF)

Ask
View Details
Recombinant Brucella ovis Imidazole glycerol phosphate synthase subunit HisF (hisF)
MBS1230208-05 0.02 mg (Baculovirus)

Recombinant Brucella ovis Imidazole glycerol phosphate synthase subunit HisF (hisF)

Ask
View Details
Recombinant Brucella ovis Imidazole glycerol phosphate synthase subunit HisF (hisF)
MBS1230208-06 0.02 mg (Mammalian-Cell)

Recombinant Brucella ovis Imidazole glycerol phosphate synthase subunit HisF (hisF)

Ask
View Details