Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Apomastus schlingeri U1-cyrtautoxin-As1c

Product Specifications

Product Name Alternative

Aptotoxin VI Aptotoxin-6 Paralytic peptide VI Short name:PP VI

Abbreviation

Recombinant Apomastus schlingeri U1-cyrtautoxin-As1c protein

UniProt

P49270

Expression Region

1-76aa

Organism

Apomastus schlingeri

Target Sequence

EIPQNLGSGIPHDKIKLPNGQWCKTPGDLCSSSSECCKAKHSNSVTYASFCSRQWSGQQALFINQCRTCNVESSMC

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Is both paralytic and lethal, when injected into lepidopteran larvae.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Is both paralytic and lethal, when injected into lepidopteran larvae.

Molecular Weight

12.3 kDa

References & Citations

"Identification of insecticidal peptides from venom of the trap-door spider, Aptostichus schlingeri (Ctenizidae) ."Skinner W.S., Dennis P.A., Li J.P., Quistad G.B.Toxicon 30:1043-1050 (1992)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD18 (Leukocyte Function Associated Antigen, LFA-1 beta2) (MaxLight 750)
MBS6260041-01 0.1 mL

CD18 (Leukocyte Function Associated Antigen, LFA-1 beta2) (MaxLight 750)

Sign In for Pricing
View Details
CD18 (Leukocyte Function Associated Antigen, LFA-1 beta2) (MaxLight 750)
MBS6260041-02 5x 0.1 mL

CD18 (Leukocyte Function Associated Antigen, LFA-1 beta2) (MaxLight 750)

Sign In for Pricing
View Details
Phosphotyrosine (P-Tyr) (PY265), CF647 conjugate, 0.1mg/mL
BNC470265-100 1x 100 µL

Phosphotyrosine (P-Tyr) (PY265), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RG2833 (RGFP109) 200mg
A13139-200 200 mg

RG2833 (RGFP109) 200mg

Sign In for Pricing
View Details
TCF2 Antibody
44484-01 50 µL

TCF2 Antibody

Sign In for Pricing
View Details
TCF2 Antibody
44484-02 100 µL

TCF2 Antibody

Sign In for Pricing
View Details