Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Apomastus schlingeri U1-cyrtautoxin-As1c

Product Specifications

Product Name Alternative

Aptotoxin VI Aptotoxin-6 Paralytic peptide VI Short name:PP VI

Abbreviation

Recombinant Apomastus schlingeri U1-cyrtautoxin-As1c protein

UniProt

P49270

Expression Region

1-76aa

Organism

Apomastus schlingeri

Target Sequence

EIPQNLGSGIPHDKIKLPNGQWCKTPGDLCSSSSECCKAKHSNSVTYASFCSRQWSGQQALFINQCRTCNVESSMC

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Is both paralytic and lethal, when injected into lepidopteran larvae.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Is both paralytic and lethal, when injected into lepidopteran larvae.

Molecular Weight

12.3 kDa

References & Citations

"Identification of insecticidal peptides from venom of the trap-door spider, Aptostichus schlingeri (Ctenizidae) ."Skinner W.S., Dennis P.A., Li J.P., Quistad G.B.Toxicon 30:1043-1050 (1992)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal Antibody to Histone Deacetylase 1 (HDAC1)
TRV-0000187-01 20 µL

Monoclonal Antibody to Histone Deacetylase 1 (HDAC1)

Sign In for Pricing
View Details
Monoclonal Antibody to Histone Deacetylase 1 (HDAC1)
TRV-0000187-02 100 µL

Monoclonal Antibody to Histone Deacetylase 1 (HDAC1)

Sign In for Pricing
View Details
Monoclonal Antibody to Histone Deacetylase 1 (HDAC1)
TRV-0000187-03 200 µL

Monoclonal Antibody to Histone Deacetylase 1 (HDAC1)

Sign In for Pricing
View Details
Monoclonal Antibody to Histone Deacetylase 1 (HDAC1)
TRV-0000187-04 1 mL

Monoclonal Antibody to Histone Deacetylase 1 (HDAC1)

Sign In for Pricing
View Details
Ttc35 ORF Vector (Rat) (pORF)
48691016 1.0 µg DNA

Ttc35 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Compound Fr16614
Fr16614-01 200 mg

Compound Fr16614

Sign In for Pricing
View Details