Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ficolin-2 (FCN2)

Product Specifications

Product Name Alternative

37KDA elastin-binding protein Collagen/fibrinogen domain-containing protein 2 EBP-37 Ficolin-B Ficolin-beta Hucolin L-ficolin Serum lectin p35

Abbreviation

Recombinant Human FCN2 protein

Gene Name

FCN2

UniProt

Q15485

Expression Region

26-313aa

Organism

Homo sapiens (Human)

Target Sequence

LQAADTCPEVKMVGLEGSDKLTILRGCPGLPGAPGPKGEAGTNGKRGERGPPGPPGKAGPPGPNGAPGEPQPCLTGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRVDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYLRGTHGSFANGINWKSGKGYNYSYKVSEMKVRPA

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Cardiovascular

Relevance

May function in innate immunity through activation of the lectin complement pathway. Calcium-dependent and GlcNAc-binding lectin. Enhances phagocytosis of S.typhimurium by neutrophils, suggesting an opsonic effect via the collagen region.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May function in innate immunity through activation of the lectin complement pathway. Calcium-dependent and GlcNAc-binding lectin. Enhances phagocytosis of S.typhimurium by neutrophils, suggesting an opsonic effect via the collagen region.

Molecular Weight

33.4 kDa

References & Citations

"A novel human serum lectin with collagen- and fibrinogen-like domains that functions as an opsonin." Matsushita M., Endo Y., Taira S., Sato Y., Fujita T., Ichikawa N., Nakata M., Mizuochi T.J. Biol. Chem. 271:2448-2454 (1996)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Brs3 Mouse qPCR Primer Pair (NM_009766)
MP201361 200 Reactions

Brs3 Mouse qPCR Primer Pair (NM_009766)

Sign In for Pricing
View Details
HHV-5/HCMV UL130 Recombinant Protein (C-Fc)
VK480011-01 50 µg

HHV-5/HCMV UL130 Recombinant Protein (C-Fc)

Sign In for Pricing
View Details
HHV-5/HCMV UL130 Recombinant Protein (C-Fc)
VK480011-02 100 µg

HHV-5/HCMV UL130 Recombinant Protein (C-Fc)

Sign In for Pricing
View Details
HHV-5/HCMV UL130 Recombinant Protein (C-Fc)
VK480011-03 1 mg

HHV-5/HCMV UL130 Recombinant Protein (C-Fc)

Sign In for Pricing
View Details
Mouse Ube2m Pre-designed siRNA Set B
SI115587B 1 Each

Mouse Ube2m Pre-designed siRNA Set B

Sign In for Pricing
View Details
Steap1 Rat siRNA Oligo Duplex (Locus ID 297738)
SR510923 1 Kit

Steap1 Rat siRNA Oligo Duplex (Locus ID 297738)

Sign In for Pricing
View Details