Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 7 (CEACAM7)

Product Specifications

Product Name Alternative

Carcinoembryonic antigen CGM2

Abbreviation

Recombinant Human CEACAM7 protein

Gene Name

CEACAM7

UniProt

Q14002

Expression Region

36-242aa

Organism

Homo sapiens (Human)

Target Sequence

TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGIYTLHVIKENLVNEEVTRQFYVFSEPPKPSITSNNFNPVENKDIVVLTCQPETQNTTYLWWVNNQSLLVSPRLLLSTDNRTLVLLSATKNDIGPYECEIQNPVGASRSDPVTLNVRYESVQAS

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Tags & Cell Markers

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

39.4 kDa

References & Citations

"CGM2, a member of the carcinoembryonic antigen gene family is down-regulated in colorectal carcinomas."Thompson J., Zimmermann W., Nollau P., Neumaier M., Weber-Arden J., Schrewe H., Craig I., Willcocks T.J. Biol. Chem. 269:32924-32931 (1994)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp41 Mouse Gene Knockout Kit (CRISPR)
KN519825 1 Kit

Zfp41 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Bone: femur, head
CS707009 5x 5 µm

Tissue FFPE Sections, Bone: femur, head

Sign In for Pricing
View Details
Human CDYL activation kit by CRISPRa
GA106293 1 Kit

Human CDYL activation kit by CRISPRa

Sign In for Pricing
View Details
PFKP Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2E10]
TA503981BM 100 µL

PFKP Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2E10]

Sign In for Pricing
View Details
1700012A03Rik Mouse Gene Knockout Kit (CRISPR)
KN500081 1 Kit

1700012A03Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Heregulin-1 / Neuregulin-1 (Breast and Urothelial Marker) (NRG1/2752), CF488A conjugate, 0.1mg/mL
BNC882752-100 1x 100 µL

Heregulin-1 / Neuregulin-1 (Breast and Urothelial Marker) (NRG1/2752), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details