Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 7 (CEACAM7)

Product Specifications

Product Name Alternative

Carcinoembryonic antigen CGM2

Abbreviation

Recombinant Human CEACAM7 protein

Gene Name

CEACAM7

UniProt

Q14002

Expression Region

36-242aa

Organism

Homo sapiens (Human)

Target Sequence

TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGIYTLHVIKENLVNEEVTRQFYVFSEPPKPSITSNNFNPVENKDIVVLTCQPETQNTTYLWWVNNQSLLVSPRLLLSTDNRTLVLLSATKNDIGPYECEIQNPVGASRSDPVTLNVRYESVQAS

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Tags & Cell Markers

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

39.4 kDa

References & Citations

"CGM2, a member of the carcinoembryonic antigen gene family is down-regulated in colorectal carcinomas."Thompson J., Zimmermann W., Nollau P., Neumaier M., Weber-Arden J., Schrewe H., Craig I., Willcocks T.J. Biol. Chem. 269:32924-32931 (1994)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Lymphoid tissue
CR562928 5 µg

Tissue Total RNA, Lymphoid tissue

Sign In for Pricing
View Details
Tuberin Recombinant Rabbit Monoclonal Antibody [SC05-59]
ET1610-10 100 µL

Tuberin Recombinant Rabbit Monoclonal Antibody [SC05-59]

Sign In for Pricing
View Details
Ugt8a Mouse Gene Knockout Kit (CRISPR)
KN318683 1 Kit

Ugt8a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SLC29A3 Human Gene Knockout Kit (CRISPR)
KN417319 1 Kit

SLC29A3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD13 Antibody
KC-984-01 50 μL

CD13 Antibody

Sign In for Pricing
View Details
CD13 Antibody
KC-984-02 100 µL

CD13 Antibody

Sign In for Pricing
View Details