Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse F-box/WD repeat-containing protein 10 (Fbxw10), partial

Product Specifications

Product Name Alternative

F-box and WD-40 domain-containing protein 10

Abbreviation

Recombinant Mouse Fbxw10 protein, partial

Gene Name

Fbxw10

UniProt

Q5SUS0

Expression Region

701-1030aa

Organism

Mus musculus (Mouse)

Target Sequence

VKWQYSSDKNKVKKSKDKEEEREETSLGDEHSRSTIQGHSLKDSVSSKQEFSKSRVHLKQTKNLSSDDMETPVGEVSHPLQKLWKVPMTPDRFLLTISALQQAHNSEEFAYPHRPRPQVIDAWGPSIPYPRKVLSLKGKSVQHAVDQLRSSNLPTGVRQTNIPLEIQKLQPNLKKSLHSPRVQATVPQPSLIRPKVSDSLRGDEHLTSSIDGTMRRAGPLTSMQVIKPNRMLAPRGGTATLSPKKERPRFYTTLDPLRMNTGFMLMTVKEEKEFAEAKMKEYEASVSTKEVDPGKASKAAWIRKIKGLPIDNFMKEGKTAAPELGQNVFI

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Probable substrate-recognition component of a SCF (SKP1-CUL1-F-box protein) -type E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Overexpression is leading to degradation of CBX5 and CBX1 (By similarity) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Probable substrate-recognition component of a SCF (SKP1-CUL1-F-box protein) -type E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Overexpression is leading to degradation of CBX5 and CBX1 (By similarity) .

Molecular Weight

53.2 kDa

References & Citations

"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC) ."The MGC Project Team Genome Res. 14:2121-2127 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Furoyl Chloride
TRC-F865200-25G 25 g

Furoyl Chloride

Sign In for Pricing
View Details
Tissue Total RNA, Ovary: left
CR563017 5 µg

Tissue Total RNA, Ovary: left

Sign In for Pricing
View Details
Human MRPL27 activation kit by CRISPRa
GA109687 1 Kit

Human MRPL27 activation kit by CRISPRa

Sign In for Pricing
View Details
HIG2 (HILPDA) Human Gene Knockout Kit (CRISPR)
KN200185LP 1 Kit

HIG2 (HILPDA) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Sodium Fruquintinib O-Desquinazolyl,-O-sulfate
TRC-S965620-25MG 25 mg

Sodium Fruquintinib O-Desquinazolyl,-O-sulfate

Sign In for Pricing
View Details
MCM7 (Proliferation Marker) (MCM7/1468), Biotin conjugate, 0.1mg/mL
BNCB1468-100 1x 100 µL

MCM7 (Proliferation Marker) (MCM7/1468), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details