Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T-cell surface glycoprotein CD3 epsilon chain (CD3E), partial

Product Specifications

Product Name Alternative

T-cell surface antigen T3/Leu-4 epsilon chain; CD_antigen: CD3e

Abbreviation

Recombinant Human CD3E protein, partial

Gene Name

CD3E

UniProt

P07766

Expression Region

23-126aa

Organism

Homo sapiens (Human)

Target Sequence

DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Immunology

Relevance

The CD3 complex mediates signal transduction, resulting in T-cell activation and proliferation. Required for normal immune responses (PubMed:15546002, PubMed:8490660) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways

Molecular Weight

13.8 kDa

References & Citations

"Isolation of cDNA clones encoding the 20K non-glycosylated polypeptide chain of the human T-cell receptor/T3 complex."Gold D.P., Puck J.M., Pettey C.L., Cho M., Coligan J., Woody J.N., Terhorst C.Nature 321:431-434 (1986)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Extracellular Domain

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal HSP90 beta Antibody (HSP90AB1/3952) [Alexa Fluor 488]
NBP3-08931AF488 100 µL

Mouse Monoclonal HSP90 beta Antibody (HSP90AB1/3952) [Alexa Fluor 488]

Ask
View Details
Rabbit Monoclonal EBAG9/RCAS1 Antibody (019) [DyLight 755]
NBP2-90266IR 0.1 mL

Rabbit Monoclonal EBAG9/RCAS1 Antibody (019) [DyLight 755]

Ask
View Details
SUB1 (SUB1 Homolog, Activated RNA Polymerase II Transcriptional Coactivator p15, p14, P15, Positive Cofactor 4, PC4, RPO2TC1) APC
MBS6139363-01 0.1 mL

SUB1 (SUB1 Homolog, Activated RNA Polymerase II Transcriptional Coactivator p15, p14, P15, Positive Cofactor 4, PC4, RPO2TC1) APC

Ask
View Details
SUB1 (SUB1 Homolog, Activated RNA Polymerase II Transcriptional Coactivator p15, p14, P15, Positive Cofactor 4, PC4, RPO2TC1) APC
MBS6139363-02 5x 0.1 mL

SUB1 (SUB1 Homolog, Activated RNA Polymerase II Transcriptional Coactivator p15, p14, P15, Positive Cofactor 4, PC4, RPO2TC1) APC

Ask
View Details
Polg2 Rat shRNA Plasmid (Locus ID 303612)
TR705632 1 Kit

Polg2 Rat shRNA Plasmid (Locus ID 303612)

Ask
View Details
Rabbit Polyclonal ZNRF2 Antibody [Alexa Fluor 647]
NBP1-28697AF647 0.1 mL

Rabbit Polyclonal ZNRF2 Antibody [Alexa Fluor 647]

Ask
View Details