Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hypocrea jecorina Class II hydrophobin 1 (hfb1)

Product Specifications

Product Name Alternative

Hydrophobin I Short name:HFBI

Abbreviation

Recombinant Hypocrea jecorina hfb1 protein

Gene Name

Hfb1

UniProt

P52754

Expression Region

23-97aa

Organism

Hypocrea jecorina (Trichoderma reesei)

Target Sequence

SNGNGNVCPPGLFSNPQCCATQVLGLIGLDCKVPSQNVYDGTDFRNVCAKTGAQPLCCVAPVAGQALLCQTAVGA

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Microbiology

Relevance

Contributes to surface hydrophobicity, which is important for processes such as association of hyphae in reproductive structures, dispersal of aerial spores and adhesion of pathogens to host structures.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Contributes to surface hydrophobicity, which is important for processes such as association of hyphae in reproductive structures, dispersal of aerial spores and adhesion of pathogens to host structures.

Molecular Weight

23.5 kDa

References & Citations

"Genetic and biochemical characterization of the Trichoderma reesei hydrophobin HFBI."Nakari-Setaelae T., Aro N., Kalkkinen N., Alatalo E., Penttilae M.Eur. J. Biochem. 235:248-255 (1996)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Tight Junction Protein 1 (TJP1) ELISA Kit
RD-TJP1-Ra-01 96 Tests

Rat Tight Junction Protein 1 (TJP1) ELISA Kit

Sign In for Pricing
View Details
Rat Tight Junction Protein 1 (TJP1) ELISA Kit
RD-TJP1-Ra-02 48 Tests

Rat Tight Junction Protein 1 (TJP1) ELISA Kit

Sign In for Pricing
View Details
SmaI, 50 preps
FDRE1336 50 Preparations

SmaI, 50 preps

Sign In for Pricing
View Details
3-Azido-3-deoxy-1,2:5,6-di-O-isopropylidene-Alpha-D-glucofuranose
TRC-A824000-50MG 50 mg

3-Azido-3-deoxy-1,2:5,6-di-O-isopropylidene-Alpha-D-glucofuranose

Sign In for Pricing
View Details
B4galnt4 Mouse Gene Knockout Kit (CRISPR)
KN501934 1 Kit

B4galnt4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PARP1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5F1]
TA804938BM 100 µL

PARP1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5F1]

Sign In for Pricing
View Details