Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella flexneri Glutaredoxin-4 (grxD)

Product Specifications

Product Name Alternative

Monothiol glutaredoxin

Abbreviation

Recombinant Shigella flexneri grxD protein

Gene Name

GrxD

UniProt

P0AC72

Expression Region

1-115aa

Organism

Shigella flexneri

Target Sequence

MSTTIEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALAACGERFAYVDILQNPDIRAELPKYANWPTFPQLWVDGELVGGCDIVIEMYQRGELQQLIKETAAKYKSEEPDAE

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Microbiology

Relevance

Monothiol glutaredoxin involved in the biogenesis of iron-sulfur clusters.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Monothiol glutaredoxin involved in the biogenesis of iron-sulfur clusters.

Molecular Weight

14.9 kDa

References & Citations

"Genome sequence of Shigella flexneri 2a: insights into pathogenicity through comparison with genomes of Escherichia coli K12 and O157."Jin Q., Yuan Z., Xu J., Wang Y., Shen Y., Lu W., Wang J., Liu H., Yang J., Yang F., Zhang X., Zhang J., Yang G., Wu H., Qu D., Dong J., Sun L., Xue Y. Yu J.Nucleic Acids Res. 30:4432-4441 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tamsolusin Hydrochloride
M37357-01 1 g

Tamsolusin Hydrochloride

Sign In for Pricing
View Details
Tamsolusin Hydrochloride
M37357-02 500 mg

Tamsolusin Hydrochloride

Sign In for Pricing
View Details
Tamsolusin Hydrochloride
M37357-03 5 mg

Tamsolusin Hydrochloride

Sign In for Pricing
View Details
Tamsolusin Hydrochloride
M37357-04 10 mg

Tamsolusin Hydrochloride

Sign In for Pricing
View Details
Tamsolusin Hydrochloride
M37357-05 25 mg

Tamsolusin Hydrochloride

Sign In for Pricing
View Details
Tamsolusin Hydrochloride
M37357-06 50 mg

Tamsolusin Hydrochloride

Sign In for Pricing
View Details