Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Fetuin-B (Fetub)

Product Specifications

Product Name Alternative

Fetuin-like protein IRL685

Abbreviation

Recombinant Rat Fetub protein

Gene Name

Fetub

UniProt

Q9QX79

Expression Region

19-378aa

Organism

Rattus norvegicus (Rat)

Target Sequence

RSPPAPPLPNAPFAPLRPLGCNDSEVLAVAGFALQNINRVQKDGYMLTLNRVHDARVHRQEDMGSLFYLMLDVLETGCHVLSRKALKDCGPRIFYETVHGQCKAMFHVNKPRRVLYLPAYNCTLRPVSKRKIHSMCPDCPHPVDLSAPSVLEAATESLAKFNSENPSKQYALVKVTKATTQWVVGPSYFVEYLIKESPCTQSQDSCSLQASDSEPVGLCQGSLIKSPGVPPQRFKKTVTVSCEFFESQDQVPGGENPADTQDAKKLPQKNTAPTSSPSITAPRGSIQHLPEQEEPEDSKGKSPEEPFPVQLDLTTNPQGDTLDVSFLYLEPEEKKLVVLPFPGKEQRSPECPGPEKQRTP

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Cardiovascular

Relevance

Protease inhibitor required for egg fertilization. Required to prevent premature zona pellucida hardening before fertilization, probably by inhibiting the protease activity of ASTL, a protease that mediates the cleavage of ZP2 and triggers zona pellucida hardening

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Protease inhibitor required for egg fertilization. Required to prevent premature zona pellucida hardening before fertilization, probably by inhibiting the protease activity of ASTL, a protease that mediates the cleavage of ZP2 and triggers zona pellucida hardening (By similarity) .

Molecular Weight

41.7 kDa

References & Citations

"Fetuin-B, a second member of the fetuin family in mammals."Olivier E., Soury E., Ruminy P., Husson A., Parmentier F., Daveau M., Salier J.-P.Biochem. J. 350:589-597 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

W/W050/NL441/PP-297X105-1 Marine & IMO Signs (No Adhesive)
301103 1 Pack (1 Panel (s) x 1 Pack)

W/W050/NL441/PP-297X105-1 Marine & IMO Signs (No Adhesive)

Sign In for Pricing
View Details
Chchd1 Rat shRNA Plasmid (Locus ID 361005)
TR706907 1 Kit

Chchd1 Rat shRNA Plasmid (Locus ID 361005)

Sign In for Pricing
View Details
IFluor® 750 Anti-human CD62p Antibody *HI62P*
106220L0-AAT 100 Tests

IFluor® 750 Anti-human CD62p Antibody *HI62P*

Sign In for Pricing
View Details
BNIP3, BH3 Domain (NIP3, BCL2/Adenovirus E1B 19kD Protein-interacting Protein 3) (MaxLight 550) discontinued
B2199-95A-ML550 100 µL

BNIP3, BH3 Domain (NIP3, BCL2/Adenovirus E1B 19kD Protein-interacting Protein 3) (MaxLight 550) discontinued

Sign In for Pricing
View Details
MTMR11 Double Nickase Plasmid (h)
sc-411535-NIC 20 µg

MTMR11 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
Oligo, ssAdapter, BssH II - Xmn I (16-mer), [5'-CGC GCG AAG GGG TTC G -3']
O6046 33ug

Oligo, ssAdapter, BssH II - Xmn I (16-mer), [5'-CGC GCG AAG GGG TTC G -3']

Sign In for Pricing
View Details